Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 56603..57639 | Replicon | plasmid unnamed3 |
Accession | NZ_CP110472 | ||
Organism | Pantoea anthophila strain CL1 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | OJ965_RS02450 | Protein ID | WP_265135643.1 |
Coordinates | 56603..57178 (-) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | A0A501RV39 |
Locus tag | OJ965_RS02455 | Protein ID | WP_064691087.1 |
Coordinates | 57178..57639 (-) | Length | 154 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OJ965_RS02435 (OJ965_02435) | 54828..55154 | - | 327 | WP_265135638.1 | hypothetical protein | - |
OJ965_RS02440 (OJ965_02440) | 55393..56061 | + | 669 | WP_140034363.1 | recombinase family protein | - |
OJ965_RS02445 (OJ965_02445) | 56039..56443 | + | 405 | WP_140034362.1 | hypothetical protein | - |
OJ965_RS02450 (OJ965_02450) | 56603..57178 | - | 576 | WP_265135643.1 | PIN domain-containing protein | Toxin |
OJ965_RS02455 (OJ965_02455) | 57178..57639 | - | 462 | WP_064691087.1 | helix-turn-helix domain-containing protein | Antitoxin |
OJ965_RS02460 (OJ965_02460) | 58080..59588 | - | 1509 | WP_265135647.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
OJ965_RS02465 (OJ965_02465) | 59588..59971 | - | 384 | WP_265135649.1 | hypothetical protein | - |
OJ965_RS02470 (OJ965_02470) | 59968..61422 | - | 1455 | WP_265135651.1 | integrating conjugative element protein | - |
OJ965_RS02475 (OJ965_02475) | 61432..62406 | - | 975 | WP_265135653.1 | TIGR03756 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..73397 | 73397 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21553.83 Da Isoelectric Point: 4.4863
>T263833 WP_265135643.1 NZ_CP110472:c57178-56603 [Pantoea anthophila]
MNHTPYPVVLDACVLYPSFLRDLLIRLGLTGLYQPKWSATIEDEWQRNLLANRTDLTPEQIQRTAALMNTVVPDAMITGF
EPLIDSVDLPDVDDRHVVAASVRSNSEIIVTFNLKDFPAPALNAFGIEALHPDDFVMDLFDLNRALVLSAVTTQRSNLRR
PPMSVDEYLEALLRQGMAQTVKELSMYRLLI
MNHTPYPVVLDACVLYPSFLRDLLIRLGLTGLYQPKWSATIEDEWQRNLLANRTDLTPEQIQRTAALMNTVVPDAMITGF
EPLIDSVDLPDVDDRHVVAASVRSNSEIIVTFNLKDFPAPALNAFGIEALHPDDFVMDLFDLNRALVLSAVTTQRSNLRR
PPMSVDEYLEALLRQGMAQTVKELSMYRLLI
Download Length: 576 bp
Antitoxin
Download Length: 154 a.a. Molecular weight: 16949.47 Da Isoelectric Point: 5.9939
>AT263833 WP_064691087.1 NZ_CP110472:c57639-57178 [Pantoea anthophila]
MTNSILDSLSLPAKGEIEAAVRGQRELAAYLSTKMETQKIAIQDADNITHQIELPTSSLTLLMSILGELALGNAVQVVPV
HAELTTQEAANILNVSRPHMVKLLEDGKLPFHKTGRHRRVLFADLMKYKDQRDSESNKAMQELADLSQELGLY
MTNSILDSLSLPAKGEIEAAVRGQRELAAYLSTKMETQKIAIQDADNITHQIELPTSSLTLLMSILGELALGNAVQVVPV
HAELTTQEAANILNVSRPHMVKLLEDGKLPFHKTGRHRRVLFADLMKYKDQRDSESNKAMQELADLSQELGLY
Download Length: 462 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|