Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3528497..3529150 | Replicon | chromosome |
| Accession | NZ_CP110462 | ||
| Organism | Acinetobacter baumannii strain RBH2 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OMP06_RS16790 | Protein ID | WP_000607072.1 |
| Coordinates | 3528497..3528886 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | OMP06_RS16795 | Protein ID | WP_001288210.1 |
| Coordinates | 3528893..3529150 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMP06_RS16775 (OMP06_16775) | 3523615..3525810 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
| OMP06_RS16780 (OMP06_16780) | 3525998..3526564 | - | 567 | WP_000651536.1 | rhombosortase | - |
| OMP06_RS16785 (OMP06_16785) | 3526642..3527727 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
| OMP06_RS16790 (OMP06_16790) | 3528497..3528886 | - | 390 | WP_000607072.1 | membrane protein | Toxin |
| OMP06_RS16795 (OMP06_16795) | 3528893..3529150 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| OMP06_RS16800 (OMP06_16800) | 3529338..3530510 | + | 1173 | WP_001190549.1 | acyl-CoA dehydrogenase family protein | - |
| OMP06_RS16805 (OMP06_16805) | 3530559..3532049 | - | 1491 | WP_000415138.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| OMP06_RS16810 (OMP06_16810) | 3532231..3532608 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| OMP06_RS16815 (OMP06_16815) | 3532627..3533634 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15663.97 Da Isoelectric Point: 10.3890
>T263826 WP_000607072.1 NZ_CP110462:c3528886-3528497 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLVDWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLVDWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|