Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2159917..2160554 | Replicon | chromosome |
Accession | NZ_CP110418 | ||
Organism | Veillonella rogosae strain KCOM 3468 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OKW85_RS10070 | Protein ID | WP_265138165.1 |
Coordinates | 2160144..2160554 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C4FMM5 |
Locus tag | OKW85_RS10065 | Protein ID | WP_005384838.1 |
Coordinates | 2159917..2160147 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKW85_RS10055 (OKW85_10055) | 2157304..2158161 | + | 858 | WP_265139135.1 | methylenetetrahydrofolate reductase | - |
OKW85_RS10060 (OKW85_10060) | 2158459..2159211 | - | 753 | WP_265138164.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
OKW85_RS10065 (OKW85_10065) | 2159917..2160147 | + | 231 | WP_005384838.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OKW85_RS10070 (OKW85_10070) | 2160144..2160554 | + | 411 | WP_265138165.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OKW85_RS10075 (OKW85_10075) | 2160630..2162501 | - | 1872 | WP_265138167.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG | - |
OKW85_RS10080 (OKW85_10080) | 2162701..2164086 | - | 1386 | WP_265138169.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
OKW85_RS10085 (OKW85_10085) | 2164343..2165143 | - | 801 | WP_265138170.1 | RNA-binding cell elongation regulator Jag/EloR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15320.79 Da Isoelectric Point: 6.9684
>T263824 WP_265138165.1 NZ_CP110418:2160144-2160554 [Veillonella rogosae]
MKYMLDKNICIYAIKQEPEVVLQKILKHHPSDICISSITYAELMHGVEKSQSKDKNRLALTLLLSPIQIVDFDSHAAEEY
GKIKADLQSQGKVIGPMDLLIASHAKSKGLTIVTNNTKEFERVTQLEVEDWSKPLS
MKYMLDKNICIYAIKQEPEVVLQKILKHHPSDICISSITYAELMHGVEKSQSKDKNRLALTLLLSPIQIVDFDSHAAEEY
GKIKADLQSQGKVIGPMDLLIASHAKSKGLTIVTNNTKEFERVTQLEVEDWSKPLS
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|