Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 3264527..3265092 | Replicon | chromosome |
Accession | NZ_CP110417 | ||
Organism | Lactiplantibacillus pentosus strain OHF 23 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | F6IUY4 |
Locus tag | HPK28_RS14915 | Protein ID | WP_050339912.1 |
Coordinates | 3264745..3265092 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | HPK28_RS14910 | Protein ID | WP_082230320.1 |
Coordinates | 3264527..3264745 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HPK28_RS14895 (HPK28_14895) | 3260142..3262184 | + | 2043 | WP_056952649.1 | KUP/HAK/KT family potassium transporter | - |
HPK28_RS14900 (HPK28_14900) | 3262252..3262899 | - | 648 | WP_225351393.1 | N-acetyltransferase | - |
HPK28_RS14905 (HPK28_14905) | 3263038..3263769 | - | 732 | WP_050339911.1 | hypothetical protein | - |
HPK28_RS14910 (HPK28_14910) | 3264527..3264745 | + | 219 | WP_082230320.1 | hypothetical protein | Antitoxin |
HPK28_RS14915 (HPK28_14915) | 3264745..3265092 | + | 348 | WP_050339912.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
HPK28_RS14920 (HPK28_14920) | 3265512..3266555 | - | 1044 | WP_021337327.1 | AI-2E family transporter | - |
HPK28_RS14925 (HPK28_14925) | 3267008..3268132 | + | 1125 | WP_050339913.1 | vitamin B12 independent methionine synthase | - |
HPK28_RS14930 (HPK28_14930) | 3268287..3268670 | - | 384 | WP_050339914.1 | multidrug efflux SMR transporter | - |
HPK28_RS14935 (HPK28_14935) | 3268687..3268995 | - | 309 | WP_003639898.1 | SMR family transporter | - |
HPK28_RS14940 (HPK28_14940) | 3269371..3270009 | - | 639 | WP_050339915.1 | hemolysin III family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13406.29 Da Isoelectric Point: 9.4892
>T263822 WP_050339912.1 NZ_CP110417:3264745-3265092 [Lactiplantibacillus pentosus]
MTYLPKQKDIIWIDFDPQRGREIKKRRPAVILSSNLYTQNTGFVIVSPITSTIHDLPGYFSLNGYDIHGQVVAAQIYSFD
ARPKAGRNITYIETMRNVDFYRVAQTVYYNFDFPF
MTYLPKQKDIIWIDFDPQRGREIKKRRPAVILSSNLYTQNTGFVIVSPITSTIHDLPGYFSLNGYDIHGQVVAAQIYSFD
ARPKAGRNITYIETMRNVDFYRVAQTVYYNFDFPF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|