Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 1931232..1931805 | Replicon | chromosome |
| Accession | NZ_CP110415 | ||
| Organism | Caldimonas thermodepolymerans strain LMG 21645 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ONZ46_RS09180 | Protein ID | WP_058616348.1 |
| Coordinates | 1931518..1931805 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A554XI70 |
| Locus tag | ONZ46_RS09175 | Protein ID | WP_058616347.1 |
| Coordinates | 1931232..1931531 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONZ46_RS09135 (ONZ46_09135) | 1926235..1927821 | + | 1587 | WP_265137080.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| ONZ46_RS09140 (ONZ46_09140) | 1927878..1928807 | + | 930 | WP_265137082.1 | zinc-binding dehydrogenase | - |
| ONZ46_RS09145 (ONZ46_09145) | 1928829..1929071 | + | 243 | WP_265137083.1 | hypothetical protein | - |
| ONZ46_RS09150 (ONZ46_09150) | 1929450..1929737 | + | 288 | WP_265137085.1 | DUF6441 family protein | - |
| ONZ46_RS09155 (ONZ46_09155) | 1929741..1930241 | - | 501 | WP_265137086.1 | GNAT family N-acetyltransferase | - |
| ONZ46_RS09160 (ONZ46_09160) | 1930238..1930519 | - | 282 | WP_265137088.1 | DUF1778 domain-containing protein | - |
| ONZ46_RS09165 (ONZ46_09165) | 1930609..1930719 | - | 111 | Protein_1812 | sterol desaturase family protein | - |
| ONZ46_RS09170 (ONZ46_09170) | 1930968..1931111 | + | 144 | Protein_1813 | IS110 family transposase | - |
| ONZ46_RS09175 (ONZ46_09175) | 1931232..1931531 | + | 300 | WP_058616347.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| ONZ46_RS09180 (ONZ46_09180) | 1931518..1931805 | + | 288 | WP_058616348.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ONZ46_RS09185 (ONZ46_09185) | 1931874..1931999 | + | 126 | WP_265137092.1 | hypothetical protein | - |
| ONZ46_RS09190 (ONZ46_09190) | 1932285..1932572 | - | 288 | WP_265137093.1 | SRPBCC family protein | - |
| ONZ46_RS09195 (ONZ46_09195) | 1932629..1935919 | - | 3291 | WP_265137094.1 | DEAD/DEAH box helicase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10862.28 Da Isoelectric Point: 4.8433
>T263820 WP_058616348.1 NZ_CP110415:1931518-1931805 [Caldimonas thermodepolymerans]
VPELEWSQPARADLLAIVDYISDDNPDAAQRLKDDIEAKAAKLPEHPRLYRPGRVEGTREMVVRANYIVVYTEDPFTVRI
LRVLHAAQQWPPGQD
VPELEWSQPARADLLAIVDYISDDNPDAAQRLKDDIEAKAAKLPEHPRLYRPGRVEGTREMVVRANYIVVYTEDPFTVRI
LRVLHAAQQWPPGQD
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|