Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4189208..4189862 | Replicon | chromosome |
| Accession | NZ_CP110404 | ||
| Organism | Shigella sonnei strain S17BD05200 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | OKF41_RS21070 | Protein ID | WP_000244777.1 |
| Coordinates | 4189208..4189615 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | OKF41_RS21075 | Protein ID | WP_000354046.1 |
| Coordinates | 4189596..4189862 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKF41_RS21050 (4185165) | 4185165..4186898 | - | 1734 | WP_000813167.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| OKF41_RS21055 (4186904) | 4186904..4187614 | - | 711 | WP_000715206.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OKF41_RS21060 (4187639) | 4187639..4188535 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| OKF41_RS21065 (4188647) | 4188647..4189168 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| OKF41_RS21070 (4189208) | 4189208..4189615 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
| OKF41_RS21075 (4189596) | 4189596..4189862 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| OKF41_RS21080 (4190105) | 4190105..4191085 | + | 981 | WP_000886060.1 | tRNA-modifying protein YgfZ | - |
| OKF41_RS21085 (4191281) | 4191281..4191940 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| OKF41_RS21090 (4192104) | 4192104..4192415 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| OKF41_RS21095 (4192460) | 4192460..4193893 | + | 1434 | WP_005137189.1 | 6-phospho-beta-glucosidase BglA | - |
| OKF41_RS21100 (4193950) | 4193950..4194693 | - | 744 | WP_000951937.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T263818 WP_000244777.1 NZ_CP110404:c4189615-4189208 [Shigella sonnei]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |