Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 4059471..4060054 | Replicon | chromosome |
Accession | NZ_CP110404 | ||
Organism | Shigella sonnei strain S17BD05200 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | OKF41_RS20495 | Protein ID | WP_000254738.1 |
Coordinates | 4059471..4059806 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | OKF41_RS20500 | Protein ID | WP_000581937.1 |
Coordinates | 4059806..4060054 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKF41_RS20480 (4055358) | 4055358..4056656 | - | 1299 | WP_000036730.1 | phosphopyruvate hydratase | - |
OKF41_RS20485 (4056744) | 4056744..4058381 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
OKF41_RS20490 (4058609) | 4058609..4059400 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
OKF41_RS20495 (4059471) | 4059471..4059806 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
OKF41_RS20500 (4059806) | 4059806..4060054 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OKF41_RS20505 (4060132) | 4060132..4062366 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
OKF41_RS20510 (4062414) | 4062414..4063715 | - | 1302 | WP_039063590.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T263817 WP_000254738.1 NZ_CP110404:c4059806-4059471 [Shigella sonnei]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|