Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 2631801..2632285 Replicon chromosome
Accession NZ_CP110404
Organism Shigella sonnei strain S17BD05200

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A377EAU1
Locus tag OKF41_RS13085 Protein ID WP_014334020.1
Coordinates 2631801..2632091 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID A0A376K4R9
Locus tag OKF41_RS13090 Protein ID WP_005142544.1
Coordinates 2632091..2632285 (-) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OKF41_RS13055 (2627001) 2627001..2628077 - 1077 Protein_2538 molybdopterin-dependent oxidoreductase -
OKF41_RS13060 (2628135) 2628135..2628832 + 698 WP_094096600.1 IS1-like element IS1A family transposase -
OKF41_RS13065 (2628826) 2628826..2629614 - 789 Protein_2540 Rha family transcriptional regulator -
OKF41_RS13070 (2630147) 2630147..2630844 + 698 WP_094096600.1 IS1-like element IS1A family transposase -
OKF41_RS13075 (2630992) 2630992..2631357 - 366 WP_024174355.1 hypothetical protein -
OKF41_RS13080 (2631369) 2631369..2631521 - 153 WP_000379558.1 DUF1391 family protein -
OKF41_RS13085 (2631801) 2631801..2632091 - 291 WP_014334020.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OKF41_RS13090 (2632091) 2632091..2632285 - 195 WP_005142544.1 hypothetical protein Antitoxin
OKF41_RS13095 (2632305) 2632305..2632790 - 486 WP_053002468.1 helix-turn-helix domain-containing protein -
OKF41_RS13100 (2632917) 2632917..2633180 + 264 WP_001048456.1 helix-turn-helix transcriptional regulator -
OKF41_RS13105 (2633177) 2633177..2633602 + 426 WP_000693826.1 toxin YdaT family protein -
OKF41_RS13110 (2633674) 2633674..2634738 + 1065 WP_039063478.1 phage replisome organizer -
OKF41_RS13115 (2634745) 2634745..2635491 + 747 WP_000788740.1 ATP-binding protein -
OKF41_RS13120 (2635513) 2635513..2636238 + 726 WP_000450631.1 DUF1627 domain-containing protein -
OKF41_RS13125 (2636254) 2636254..2636676 + 423 WP_001151171.1 DUF977 family protein -
OKF41_RS13130 (2636734) 2636734..2637090 + 357 WP_005140877.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2628826..2656112 27286


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11062.93 Da        Isoelectric Point: 10.2013

>T263814 WP_014334020.1 NZ_CP110404:c2632091-2631801 [Shigella sonnei]
MLPVLWLPSARDDLRQIVAYIAKENPAAARRMKIRIETSVLPLTEHPYLYPPSERVLGLREIVTHPNYIILYRVTASSIE
VVNIVHSRRQYPGKNS

Download         Length: 291 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7097.98 Da        Isoelectric Point: 4.1759

>AT263814 WP_005142544.1 NZ_CP110404:c2632285-2632091 [Shigella sonnei]
MSTVLSPMVSEFETVEQENSYNEWLRAKVAASLADPRPAIPHDEVMAEMEQIIAQIAAATHRGE

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377EAU1

Antitoxin

Source ID Structure
AlphaFold DB A0A376K4R9

References