Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1437119..1437737 | Replicon | chromosome |
Accession | NZ_CP110404 | ||
Organism | Shigella sonnei strain S17BD05200 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | OKF41_RS06975 | Protein ID | WP_001291435.1 |
Coordinates | 1437119..1437337 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A0H8V4S8 |
Locus tag | OKF41_RS06980 | Protein ID | WP_000344804.1 |
Coordinates | 1437363..1437737 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKF41_RS06940 (1432411) | 1432411..1432983 | + | 573 | WP_000779812.1 | YbaY family lipoprotein | - |
OKF41_RS06945 (1433014) | 1433014..1433325 | - | 312 | WP_000409911.1 | MGMT family protein | - |
OKF41_RS06955 (1433704) | 1433704..1434057 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
OKF41_RS06960 (1434099) | 1434099..1435647 | - | 1549 | Protein_1344 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
OKF41_RS06965 (1435811) | 1435811..1436281 | - | 471 | WP_000136192.1 | YlaC family protein | - |
OKF41_RS06970 (1436397) | 1436397..1436948 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
OKF41_RS06975 (1437119) | 1437119..1437337 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
OKF41_RS06980 (1437363) | 1437363..1437737 | - | 375 | WP_000344804.1 | Hha toxicity modulator TomB | Antitoxin |
OKF41_RS06985 (1438283) | 1438283..1441432 | - | 3150 | WP_001132464.1 | efflux RND transporter permease AcrB | - |
OKF41_RS06990 (1441455) | 1441455..1442648 | - | 1194 | WP_011310152.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T263809 WP_001291435.1 NZ_CP110404:c1437337-1437119 [Shigella sonnei]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14615.43 Da Isoelectric Point: 4.6232
>AT263809 WP_000344804.1 NZ_CP110404:c1437737-1437363 [Shigella sonnei]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIETFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIETFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H8V4S8 |