Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1401558..1402395 | Replicon | chromosome |
Accession | NZ_CP110404 | ||
Organism | Shigella sonnei strain S17BD05200 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | OKF41_RS06795 | Protein ID | WP_000227784.1 |
Coordinates | 1401558..1402100 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | OKF41_RS06800 | Protein ID | WP_001297137.1 |
Coordinates | 1402084..1402395 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKF41_RS06765 (1396622) | 1396622..1397113 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
OKF41_RS06770 (1397241) | 1397241..1398605 | - | 1365 | WP_001000971.1 | MFS transporter | - |
OKF41_RS06775 (1398724) | 1398724..1399421 | + | 698 | WP_237158184.1 | IS1-like element IS1A family transposase | - |
OKF41_RS06780 (1399790) | 1399790..1400188 | + | 399 | Protein_1309 | SEL1-like repeat protein | - |
OKF41_RS06790 (1400936) | 1400936..1401502 | + | 567 | Protein_1311 | SEL1-like repeat protein | - |
OKF41_RS06795 (1401558) | 1401558..1402100 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
OKF41_RS06800 (1402084) | 1402084..1402395 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
OKF41_RS06805 (1402580) | 1402580..1403470 | - | 891 | WP_000971327.1 | heme o synthase | - |
OKF41_RS06810 (1403482) | 1403482..1403811 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
OKF41_RS06815 (1403811) | 1403811..1404425 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
OKF41_RS06820 (1404415) | 1404415..1406406 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
OKF41_RS06825 (1406428) | 1406428..1407375 | - | 948 | WP_265071992.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T263808 WP_000227784.1 NZ_CP110404:c1402100-1401558 [Shigella sonnei]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|