Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4368325..4369160 | Replicon | chromosome |
| Accession | NZ_CP110398 | ||
| Organism | Shigella sonnei strain S17BD06357 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1V1GYU4 |
| Locus tag | OKF40_RS21960 | Protein ID | WP_000854719.1 |
| Coordinates | 4368325..4368702 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | OKF40_RS21965 | Protein ID | WP_001285113.1 |
| Coordinates | 4368792..4369160 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKF40_RS21930 (4363917) | 4363917..4364888 | - | 972 | Protein_4267 | integrase arm-type DNA-binding domain-containing protein | - |
| OKF40_RS21935 (4365292) | 4365292..4366239 | - | 948 | WP_001440173.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| OKF40_RS21940 (4366232) | 4366232..4366627 | - | 396 | WP_000208386.1 | DUF6088 family protein | - |
| OKF40_RS21945 (4366696) | 4366696..4367540 | - | 845 | Protein_4270 | DUF4942 domain-containing protein | - |
| OKF40_RS21950 (4367625) | 4367625..4367822 | - | 198 | WP_000839266.1 | DUF957 domain-containing protein | - |
| OKF40_RS21955 (4367840) | 4367840..4368328 | - | 489 | WP_000761679.1 | DUF5983 family protein | - |
| OKF40_RS21960 (4368325) | 4368325..4368702 | - | 378 | WP_000854719.1 | TA system toxin CbtA family protein | Toxin |
| OKF40_RS21965 (4368792) | 4368792..4369160 | - | 369 | WP_001285113.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OKF40_RS21970 (4369210) | 4369210..4369854 | - | 645 | WP_000086770.1 | hypothetical protein | - |
| OKF40_RS21975 (4369873) | 4369873..4370094 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| OKF40_RS21980 (4370163) | 4370163..4370639 | - | 477 | WP_001186715.1 | RadC family protein | - |
| OKF40_RS21985 (4370655) | 4370655..4371140 | - | 486 | WP_000213705.1 | antirestriction protein | - |
| OKF40_RS21990 (4371217) | 4371217..4372035 | - | 819 | WP_001175145.1 | DUF932 domain-containing protein | - |
| OKF40_RS21995 (4372125) | 4372125..4372358 | - | 234 | WP_001278282.1 | DUF905 family protein | - |
| OKF40_RS22000 (4372364) | 4372364..4373041 | - | 678 | WP_001097369.1 | hypothetical protein | - |
| OKF40_RS22005 (4373160) | 4373160..4374044 | - | 885 | WP_000010398.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | blaCTX-M-15 | sigA | 4350306..4412677 | 62371 | |
| - | flank | IS/Tn | - | - | 4362760..4363779 | 1019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14059.10 Da Isoelectric Point: 8.2904
>T263805 WP_000854719.1 NZ_CP110398:c4368702-4368325 [Shigella sonnei]
MKTLPDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13693.33 Da Isoelectric Point: 5.4970
>AT263805 WP_001285113.1 NZ_CP110398:c4369160-4368792 [Shigella sonnei]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTSETKT
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTSETKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|