263805

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4368325..4369160 Replicon chromosome
Accession NZ_CP110398
Organism Shigella sonnei strain S17BD06357

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1V1GYU4
Locus tag OKF40_RS21960 Protein ID WP_000854719.1
Coordinates 4368325..4368702 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag OKF40_RS21965 Protein ID WP_001285113.1
Coordinates 4368792..4369160 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OKF40_RS21930 (4363917) 4363917..4364888 - 972 Protein_4267 integrase arm-type DNA-binding domain-containing protein -
OKF40_RS21935 (4365292) 4365292..4366239 - 948 WP_001440173.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
OKF40_RS21940 (4366232) 4366232..4366627 - 396 WP_000208386.1 DUF6088 family protein -
OKF40_RS21945 (4366696) 4366696..4367540 - 845 Protein_4270 DUF4942 domain-containing protein -
OKF40_RS21950 (4367625) 4367625..4367822 - 198 WP_000839266.1 DUF957 domain-containing protein -
OKF40_RS21955 (4367840) 4367840..4368328 - 489 WP_000761679.1 DUF5983 family protein -
OKF40_RS21960 (4368325) 4368325..4368702 - 378 WP_000854719.1 TA system toxin CbtA family protein Toxin
OKF40_RS21965 (4368792) 4368792..4369160 - 369 WP_001285113.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OKF40_RS21970 (4369210) 4369210..4369854 - 645 WP_000086770.1 hypothetical protein -
OKF40_RS21975 (4369873) 4369873..4370094 - 222 WP_000692345.1 DUF987 domain-containing protein -
OKF40_RS21980 (4370163) 4370163..4370639 - 477 WP_001186715.1 RadC family protein -
OKF40_RS21985 (4370655) 4370655..4371140 - 486 WP_000213705.1 antirestriction protein -
OKF40_RS21990 (4371217) 4371217..4372035 - 819 WP_001175145.1 DUF932 domain-containing protein -
OKF40_RS21995 (4372125) 4372125..4372358 - 234 WP_001278282.1 DUF905 family protein -
OKF40_RS22000 (4372364) 4372364..4373041 - 678 WP_001097369.1 hypothetical protein -
OKF40_RS22005 (4373160) 4373160..4374044 - 885 WP_000010398.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island blaCTX-M-15 sigA 4350306..4412677 62371
- flank IS/Tn - - 4362760..4363779 1019


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14059.10 Da        Isoelectric Point: 8.2904

>T263805 WP_000854719.1 NZ_CP110398:c4368702-4368325 [Shigella sonnei]
MKTLPDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13693.33 Da        Isoelectric Point: 5.4970

>AT263805 WP_001285113.1 NZ_CP110398:c4369160-4368792 [Shigella sonnei]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYARGLTCEADTLGSCGYVYLAVYPTSETKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1V1GYU4

Antitoxin

Source ID Structure

References