Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4172725..4173379 | Replicon | chromosome |
Accession | NZ_CP110398 | ||
Organism | Shigella sonnei strain S17BD06357 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | OKF40_RS20955 | Protein ID | WP_000244777.1 |
Coordinates | 4172725..4173132 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | OKF40_RS20960 | Protein ID | WP_000354046.1 |
Coordinates | 4173113..4173379 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKF40_RS20935 (4168682) | 4168682..4170415 | - | 1734 | WP_000813167.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OKF40_RS20940 (4170421) | 4170421..4171131 | - | 711 | WP_000715206.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OKF40_RS20945 (4171156) | 4171156..4172052 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
OKF40_RS20950 (4172164) | 4172164..4172685 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
OKF40_RS20955 (4172725) | 4172725..4173132 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
OKF40_RS20960 (4173113) | 4173113..4173379 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
OKF40_RS20965 (4173622) | 4173622..4174602 | + | 981 | WP_000886060.1 | tRNA-modifying protein YgfZ | - |
OKF40_RS20970 (4174798) | 4174798..4175457 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
OKF40_RS20975 (4175621) | 4175621..4175932 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
OKF40_RS20980 (4175977) | 4175977..4177410 | + | 1434 | WP_005137189.1 | 6-phospho-beta-glucosidase BglA | - |
OKF40_RS20985 (4177467) | 4177467..4178210 | - | 744 | WP_000951937.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T263802 WP_000244777.1 NZ_CP110398:c4173132-4172725 [Shigella sonnei]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |