Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 2617420..2617904 Replicon chromosome
Accession NZ_CP110398
Organism Shigella sonnei strain S17BD06357

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A377EAU1
Locus tag OKF40_RS12975 Protein ID WP_014334020.1
Coordinates 2617420..2617710 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID A0A376K4R9
Locus tag OKF40_RS12980 Protein ID WP_005142544.1
Coordinates 2617710..2617904 (-) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OKF40_RS12945 (2612620) 2612620..2613696 - 1077 Protein_2514 molybdopterin-dependent oxidoreductase -
OKF40_RS12950 (2613754) 2613754..2614451 + 698 WP_094096600.1 IS1-like element IS1A family transposase -
OKF40_RS12955 (2614445) 2614445..2615233 - 789 Protein_2516 Rha family transcriptional regulator -
OKF40_RS12960 (2615766) 2615766..2616463 + 698 WP_094096600.1 IS1-like element IS1A family transposase -
OKF40_RS12965 (2616611) 2616611..2616976 - 366 WP_024174355.1 hypothetical protein -
OKF40_RS12970 (2616988) 2616988..2617140 - 153 WP_000379558.1 DUF1391 family protein -
OKF40_RS12975 (2617420) 2617420..2617710 - 291 WP_014334020.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OKF40_RS12980 (2617710) 2617710..2617904 - 195 WP_005142544.1 hypothetical protein Antitoxin
OKF40_RS12985 (2617924) 2617924..2618409 - 486 WP_053002468.1 helix-turn-helix domain-containing protein -
OKF40_RS12990 (2618536) 2618536..2618799 + 264 WP_001048456.1 helix-turn-helix transcriptional regulator -
OKF40_RS12995 (2618796) 2618796..2619221 + 426 WP_000693826.1 toxin YdaT family protein -
OKF40_RS13000 (2619293) 2619293..2620357 + 1065 WP_039063478.1 phage replisome organizer -
OKF40_RS13005 (2620364) 2620364..2621110 + 747 WP_000788740.1 ATP-binding protein -
OKF40_RS13010 (2621132) 2621132..2621857 + 726 WP_000450631.1 DUF1627 domain-containing protein -
OKF40_RS13015 (2621873) 2621873..2622295 + 423 WP_001151171.1 DUF977 family protein -
OKF40_RS13020 (2622353) 2622353..2622709 + 357 WP_005140877.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2611136..2626706 15570


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11062.93 Da        Isoelectric Point: 10.2013

>T263798 WP_014334020.1 NZ_CP110398:c2617710-2617420 [Shigella sonnei]
MLPVLWLPSARDDLRQIVAYIAKENPAAARRMKIRIETSVLPLTEHPYLYPPSERVLGLREIVTHPNYIILYRVTASSIE
VVNIVHSRRQYPGKNS

Download         Length: 291 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7097.98 Da        Isoelectric Point: 4.1759

>AT263798 WP_005142544.1 NZ_CP110398:c2617904-2617710 [Shigella sonnei]
MSTVLSPMVSEFETVEQENSYNEWLRAKVAASLADPRPAIPHDEVMAEMEQIIAQIAAATHRGE

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377EAU1

Antitoxin

Source ID Structure
AlphaFold DB A0A376K4R9

References