Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 1402115..1402952 | Replicon | chromosome |
| Accession | NZ_CP110398 | ||
| Organism | Shigella sonnei strain S17BD06357 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | OKF40_RS06790 | Protein ID | WP_000227784.1 |
| Coordinates | 1402115..1402657 (-) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | OKF40_RS06795 | Protein ID | WP_001297137.1 |
| Coordinates | 1402641..1402952 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKF40_RS06760 (1397179) | 1397179..1397670 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| OKF40_RS06765 (1397798) | 1397798..1399162 | - | 1365 | WP_001000971.1 | MFS transporter | - |
| OKF40_RS06770 (1399281) | 1399281..1399978 | + | 698 | WP_094096600.1 | IS1-like element IS1A family transposase | - |
| OKF40_RS06775 (1400347) | 1400347..1400745 | + | 399 | Protein_1307 | SEL1-like repeat protein | - |
| OKF40_RS06785 (1401493) | 1401493..1402059 | + | 567 | Protein_1309 | SEL1-like repeat protein | - |
| OKF40_RS06790 (1402115) | 1402115..1402657 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| OKF40_RS06795 (1402641) | 1402641..1402952 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| OKF40_RS06800 (1403137) | 1403137..1404027 | - | 891 | WP_000971327.1 | heme o synthase | - |
| OKF40_RS06805 (1404039) | 1404039..1404368 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| OKF40_RS06810 (1404368) | 1404368..1404982 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| OKF40_RS06815 (1404972) | 1404972..1406963 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| OKF40_RS06820 (1406985) | 1406985..1407932 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T263792 WP_000227784.1 NZ_CP110398:c1402657-1402115 [Shigella sonnei]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|