Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 4293908..4294497 Replicon chromosome
Accession NZ_CP110395
Organism Paraburkholderia sp. D15

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag LFL96_RS18820 Protein ID WP_280996711.1
Coordinates 4293908..4294090 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag LFL96_RS18825 Protein ID WP_280996713.1
Coordinates 4294087..4294497 (+) Length 137 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LFL96_RS18790 (LFL96_18795) 4289446..4289871 - 426 WP_012434707.1 flagellar basal body rod protein FlgC -
LFL96_RS18795 (LFL96_18800) 4290088..4290582 - 495 WP_280996706.1 flagellar basal body rod protein FlgB -
LFL96_RS18800 (LFL96_18805) 4290800..4292479 + 1680 WP_280996707.1 flagellar basal body P-ring formation chaperone FlgA -
LFL96_RS18805 (LFL96_18810) 4292470..4292622 - 153 WP_280996708.1 hypothetical protein -
LFL96_RS18810 (LFL96_18815) 4292624..4292980 + 357 WP_280996709.1 flagellar biosynthesis anti-sigma factor FlgM -
LFL96_RS18815 (LFL96_18820) 4293075..4293521 + 447 WP_280996710.1 flagellar protein FlgN -
LFL96_RS18820 (LFL96_18825) 4293908..4294090 + 183 WP_280996711.1 type II toxin-antitoxin system HicA family toxin Toxin
LFL96_RS18825 (LFL96_18830) 4294087..4294497 + 411 WP_280996713.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
LFL96_RS18830 (LFL96_18835) 4294609..4295343 - 735 WP_007179960.1 RNA polymerase sigma factor FliA -
LFL96_RS18835 (LFL96_18840) 4295372..4296241 - 870 WP_280996714.1 AAA family ATPase -
LFL96_RS18840 (LFL96_18845) 4296234..4298291 - 2058 WP_280996715.1 flagellar biosynthesis protein FlhF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(6-129)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6585.77 Da        Isoelectric Point: 11.8222

>T263787 WP_280996711.1 NZ_CP110395:4293908-4294090 [Paraburkholderia sp. D15]
MNSAQVVKLIQAEGWNLVRISGSHRHFRHPLKGGLVTIPHPKKDLPPGTLNSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 137 a.a.        Molecular weight: 14866.04 Da        Isoelectric Point: 4.7424

>AT263787 WP_280996713.1 NZ_CP110395:4294087-4294497 [Paraburkholderia sp. D15]
MKNLIFPIAIEAGDKQHAFGVVVPDIPGCFAAGDTLEEAYENVKAAIESHLDTLLDEGMPLPQAGKLDEHRRNPDYAGFV
WGFVVTRNIPALKKSVRINISLPEVLIQDIDSYAQTRGMSRSAFLALAAEREMVAA

Download         Length: 411 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References