Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 1952497..1953136 | Replicon | chromosome |
| Accession | NZ_CP110395 | ||
| Organism | Paraburkholderia sp. D15 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LFL96_RS08415 | Protein ID | WP_281000085.1 |
| Coordinates | 1952720..1953136 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | LFL96_RS08410 | Protein ID | WP_281000083.1 |
| Coordinates | 1952497..1952733 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LFL96_RS08380 (LFL96_08380) | 1947711..1948220 | - | 510 | WP_281000071.1 | Spy/CpxP family protein refolding chaperone | - |
| LFL96_RS08385 (LFL96_08385) | 1948419..1949303 | + | 885 | WP_281000073.1 | LysR family transcriptional regulator | - |
| LFL96_RS08390 (LFL96_08390) | 1949463..1949921 | + | 459 | WP_281000075.1 | Lrp/AsnC family transcriptional regulator | - |
| LFL96_RS08395 (LFL96_08395) | 1950178..1951275 | + | 1098 | WP_281000077.1 | saccharopine dehydrogenase NADP-binding domain-containing protein | - |
| LFL96_RS08400 (LFL96_08400) | 1951414..1952034 | - | 621 | WP_281000079.1 | ATP-binding protein | - |
| LFL96_RS08405 (LFL96_08405) | 1952031..1952177 | - | 147 | WP_281000081.1 | cytochrome bd-I oxidase subunit CydX | - |
| LFL96_RS08410 (LFL96_08410) | 1952497..1952733 | + | 237 | WP_281000083.1 | DNA-binding protein | Antitoxin |
| LFL96_RS08415 (LFL96_08415) | 1952720..1953136 | + | 417 | WP_281000085.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LFL96_RS08420 (LFL96_08420) | 1953224..1953697 | + | 474 | WP_281000087.1 | hypothetical protein | - |
| LFL96_RS08425 (LFL96_08425) | 1953820..1954797 | + | 978 | WP_281000089.1 | magnesium/cobalt transporter CorA | - |
| LFL96_RS08430 (LFL96_08430) | 1955220..1956182 | + | 963 | WP_281000091.1 | sugar ABC transporter substrate-binding protein | - |
| LFL96_RS08435 (LFL96_08435) | 1956671..1957711 | + | 1041 | WP_281000093.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15679.19 Da Isoelectric Point: 10.2689
>T263784 WP_281000085.1 NZ_CP110395:1952720-1953136 [Paraburkholderia sp. D15]
MYLIDTNVISEIRRWERANAGVRRFFRQAEQEGRKLYLSVVTVGELRRGVEQVRYRGDLMQAAVLERWMNTVLKRFAKSI
LSIDEIAAHVWGKLRVPHSEPAVDKLIAATALSCDLVVVTRNVADFAGPGIRVVNPFD
MYLIDTNVISEIRRWERANAGVRRFFRQAEQEGRKLYLSVVTVGELRRGVEQVRYRGDLMQAAVLERWMNTVLKRFAKSI
LSIDEIAAHVWGKLRVPHSEPAVDKLIAATALSCDLVVVTRNVADFAGPGIRVVNPFD
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|