Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 6104788..6105409 | Replicon | chromosome |
| Accession | NZ_CP110389 | ||
| Organism | Rhodopseudomonas sp. P2A-2r | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | ONR75_RS29400 | Protein ID | WP_265080352.1 |
| Coordinates | 6104788..6105189 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | ONR75_RS29405 | Protein ID | WP_265080353.1 |
| Coordinates | 6105179..6105409 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR75_RS29380 (ONR75_29380) | 6100499..6101167 | + | 669 | WP_265080350.1 | hypothetical protein | - |
| ONR75_RS29385 (ONR75_29385) | 6101315..6101860 | - | 546 | WP_265080351.1 | adenine phosphoribosyltransferase | - |
| ONR75_RS29390 (ONR75_29390) | 6101885..6104086 | - | 2202 | WP_265083845.1 | anthranilate synthase component I | - |
| ONR75_RS29395 (ONR75_29395) | 6104308..6104775 | - | 468 | Protein_5827 | GNAT family N-acetyltransferase | - |
| ONR75_RS29400 (ONR75_29400) | 6104788..6105189 | - | 402 | WP_265080352.1 | PIN domain-containing protein | Toxin |
| ONR75_RS29405 (ONR75_29405) | 6105179..6105409 | - | 231 | WP_265080353.1 | AbrB family transcriptional regulator | Antitoxin |
| ONR75_RS29410 (ONR75_29410) | 6105463..6105931 | - | 469 | Protein_5830 | GNAT family N-acetyltransferase | - |
| ONR75_RS29415 (ONR75_29415) | 6105948..6106622 | - | 675 | WP_265080354.1 | dienelactone hydrolase family protein | - |
| ONR75_RS29420 (ONR75_29420) | 6106674..6107495 | - | 822 | WP_265083846.1 | hypothetical protein | - |
| ONR75_RS29425 (ONR75_29425) | 6107531..6107950 | - | 420 | WP_265080355.1 | NAD(P)-binding domain-containing protein | - |
| ONR75_RS29430 (ONR75_29430) | 6107947..6108918 | - | 972 | WP_265080356.1 | SDR family oxidoreductase | - |
| ONR75_RS29435 (ONR75_29435) | 6108915..6109853 | - | 939 | WP_265080357.1 | bile acid:sodium symporter family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14916.14 Da Isoelectric Point: 4.5625
>T263782 WP_265080352.1 NZ_CP110389:c6105189-6104788 [Rhodopseudomonas sp. P2A-2r]
MSVSFFDSNVLLYLASDEPDRVLRVRQLVDSGGIISVQILNEMTSVSRRKFGMSWSETRALLTEMRDLLAIVPLTPEIHE
SGIRLAERYGFAVYDSFIVAAALAADCDTLWSEDMQNGMLVEGRLRIANPFRA
MSVSFFDSNVLLYLASDEPDRVLRVRQLVDSGGIISVQILNEMTSVSRRKFGMSWSETRALLTEMRDLLAIVPLTPEIHE
SGIRLAERYGFAVYDSFIVAAALAADCDTLWSEDMQNGMLVEGRLRIANPFRA
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|