Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 5583450..5583976 | Replicon | chromosome |
Accession | NZ_CP110389 | ||
Organism | Rhodopseudomonas sp. P2A-2r |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | ONR75_RS26995 | Protein ID | WP_265079954.1 |
Coordinates | 5583653..5583976 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | ONR75_RS26990 | Protein ID | WP_265079953.1 |
Coordinates | 5583450..5583656 (+) | Length | 69 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONR75_RS26970 (ONR75_26970) | 5579471..5580477 | + | 1007 | Protein_5343 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
ONR75_RS26975 (ONR75_26975) | 5580653..5581855 | + | 1203 | WP_265079950.1 | phosphoglycerate kinase | - |
ONR75_RS26980 (ONR75_26980) | 5581938..5582156 | + | 219 | WP_265079951.1 | hypothetical protein | - |
ONR75_RS26985 (ONR75_26985) | 5582314..5583381 | + | 1068 | WP_265079952.1 | fructose-bisphosphate aldolase class II | - |
ONR75_RS26990 (ONR75_26990) | 5583450..5583656 | + | 207 | WP_265079953.1 | antitoxin MazE family protein | Antitoxin |
ONR75_RS26995 (ONR75_26995) | 5583653..5583976 | + | 324 | WP_265079954.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
ONR75_RS27000 (ONR75_27000) | 5584009..5585042 | + | 1034 | Protein_5349 | fructose-bisphosphate aldolase class I | - |
ONR75_RS27005 (ONR75_27005) | 5585049..5585729 | + | 681 | WP_265079955.1 | thiamine phosphate synthase | - |
ONR75_RS27010 (ONR75_27010) | 5585738..5586820 | + | 1083 | WP_265079956.1 | tetratricopeptide repeat protein | - |
ONR75_RS27015 (ONR75_27015) | 5586926..5587711 | + | 786 | WP_265079957.1 | inositol monophosphatase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11584.50 Da Isoelectric Point: 10.0103
>T263781 WP_265079954.1 NZ_CP110389:5583653-5583976 [Rhodopseudomonas sp. P2A-2r]
MKRGDLVTAVMQGAYGKARPAVIIQATWVEGLNSVTFLPLTSELSTARIFRILVEPTSENGLQVTSQVMADKCATLPRTK
IGPVFGRLASNDMERVDRAFAIFTGLA
MKRGDLVTAVMQGAYGKARPAVIIQATWVEGLNSVTFLPLTSELSTARIFRILVEPTSENGLQVTSQVMADKCATLPRTK
IGPVFGRLASNDMERVDRAFAIFTGLA
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|