Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1887592..1888391 | Replicon | chromosome |
| Accession | NZ_CP110377 | ||
| Organism | Proteus mirabilis strain NYP73 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | A0A8E3RD10 |
| Locus tag | ONR65_RS09215 | Protein ID | WP_004247966.1 |
| Coordinates | 1887867..1888391 (+) | Length | 175 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | B4EVS2 |
| Locus tag | ONR65_RS09210 | Protein ID | WP_004247964.1 |
| Coordinates | 1887592..1887870 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR65_RS09185 (ONR65_09185) | 1882942..1884024 | + | 1083 | WP_004242680.1 | peptide chain release factor 1 | - |
| ONR65_RS09190 (ONR65_09190) | 1884024..1884872 | + | 849 | WP_004251398.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| ONR65_RS09195 (ONR65_09195) | 1884850..1885665 | + | 816 | WP_004242688.1 | invasion regulator SirB1 | - |
| ONR65_RS09200 (ONR65_09200) | 1885723..1886577 | + | 855 | WP_004242689.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| ONR65_RS09205 (ONR65_09205) | 1886585..1887514 | + | 930 | WP_004242691.1 | TIGR01212 family radical SAM protein | - |
| ONR65_RS09210 (ONR65_09210) | 1887592..1887870 | + | 279 | WP_004247964.1 | DUF1778 domain-containing protein | Antitoxin |
| ONR65_RS09215 (ONR65_09215) | 1887867..1888391 | + | 525 | WP_004247966.1 | hypothetical protein | Toxin |
| ONR65_RS09220 (ONR65_09220) | 1888472..1890172 | - | 1701 | WP_004247967.1 | C4-dicarboxylic acid transporter DauA | - |
| ONR65_RS09230 (ONR65_09230) | 1891136..1892077 | + | 942 | WP_004242695.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19192.12 Da Isoelectric Point: 9.3561
>T263777 WP_004247966.1 NZ_CP110377:1887867-1888391 [Proteus mirabilis]
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|