Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1887644..1888443 | Replicon | chromosome |
Accession | NZ_CP110376 | ||
Organism | Proteus mirabilis strain NYP69 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A8E3RD10 |
Locus tag | ONR68_RS09190 | Protein ID | WP_004247966.1 |
Coordinates | 1887919..1888443 (+) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | B4EVS2 |
Locus tag | ONR68_RS09185 | Protein ID | WP_004247964.1 |
Coordinates | 1887644..1887922 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONR68_RS09160 (ONR68_09160) | 1882994..1884076 | + | 1083 | WP_004242680.1 | peptide chain release factor 1 | - |
ONR68_RS09165 (ONR68_09165) | 1884076..1884924 | + | 849 | WP_004251398.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
ONR68_RS09170 (ONR68_09170) | 1884902..1885717 | + | 816 | WP_004242688.1 | invasion regulator SirB1 | - |
ONR68_RS09175 (ONR68_09175) | 1885775..1886629 | + | 855 | WP_004242689.1 | 3-deoxy-8-phosphooctulonate synthase | - |
ONR68_RS09180 (ONR68_09180) | 1886637..1887566 | + | 930 | WP_004242691.1 | TIGR01212 family radical SAM protein | - |
ONR68_RS09185 (ONR68_09185) | 1887644..1887922 | + | 279 | WP_004247964.1 | DUF1778 domain-containing protein | Antitoxin |
ONR68_RS09190 (ONR68_09190) | 1887919..1888443 | + | 525 | WP_004247966.1 | hypothetical protein | Toxin |
ONR68_RS09195 (ONR68_09195) | 1888524..1890224 | - | 1701 | WP_004247967.1 | C4-dicarboxylic acid transporter DauA | - |
ONR68_RS09205 (ONR68_09205) | 1891188..1892129 | + | 942 | WP_004242695.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19192.12 Da Isoelectric Point: 9.3561
>T263772 WP_004247966.1 NZ_CP110376:1887919-1888443 [Proteus mirabilis]
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|