Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1556697..1557342 | Replicon | chromosome |
| Accession | NZ_CP110376 | ||
| Organism | Proteus mirabilis strain NYP69 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B4ET86 |
| Locus tag | ONR68_RS07340 | Protein ID | WP_004247035.1 |
| Coordinates | 1557157..1557342 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | B4ET85 |
| Locus tag | ONR68_RS07335 | Protein ID | WP_004247034.1 |
| Coordinates | 1556697..1557110 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR68_RS07305 (ONR68_07305) | 1552244..1552402 | - | 159 | WP_004247025.1 | hypothetical protein | - |
| ONR68_RS07310 (ONR68_07310) | 1552854..1553030 | + | 177 | WP_004247026.1 | hypothetical protein | - |
| ONR68_RS07315 (ONR68_07315) | 1553207..1553953 | - | 747 | Protein_1407 | methyltransferase domain-containing protein | - |
| ONR68_RS07320 (ONR68_07320) | 1554803..1555381 | + | 579 | WP_004247030.1 | alpha/beta hydrolase | - |
| ONR68_RS07325 (ONR68_07325) | 1555494..1555736 | - | 243 | WP_230458803.1 | hypothetical protein | - |
| ONR68_RS07330 (ONR68_07330) | 1556101..1556601 | - | 501 | WP_041707083.1 | response regulator | - |
| ONR68_RS07335 (ONR68_07335) | 1556697..1557110 | - | 414 | WP_004247034.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| ONR68_RS07340 (ONR68_07340) | 1557157..1557342 | - | 186 | WP_004247035.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| ONR68_RS07345 (ONR68_07345) | 1557448..1557915 | + | 468 | WP_223293438.1 | DUF1073 domain-containing protein | - |
| ONR68_RS07350 (ONR68_07350) | 1557858..1558226 | + | 369 | WP_223232026.1 | DUF1073 domain-containing protein | - |
| ONR68_RS07355 (ONR68_07355) | 1558229..1558447 | + | 219 | Protein_1415 | hypothetical protein | - |
| ONR68_RS07360 (ONR68_07360) | 1558517..1558669 | + | 153 | WP_004247038.1 | hypothetical protein | - |
| ONR68_RS07365 (ONR68_07365) | 1559012..1559332 | - | 321 | WP_223307228.1 | PH domain-containing protein | - |
| ONR68_RS07370 (ONR68_07370) | 1559396..1559710 | - | 315 | WP_135091643.1 | hypothetical protein | - |
| ONR68_RS07375 (ONR68_07375) | 1560310..1561326 | - | 1017 | WP_049257338.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1550560..1610873 | 60313 | |
| - | inside | Prophage | - | - | 1556101..1610873 | 54772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7049.30 Da Isoelectric Point: 10.9659
>T263771 WP_004247035.1 NZ_CP110376:c1557342-1557157 [Proteus mirabilis]
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15251.98 Da Isoelectric Point: 4.3830
>AT263771 WP_004247034.1 NZ_CP110376:c1557110-1556697 [Proteus mirabilis]
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|