Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 10493..11094 | Replicon | chromosome |
| Accession | NZ_CP110376 | ||
| Organism | Proteus mirabilis strain NYP69 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | ONR68_RS00045 | Protein ID | WP_049194960.1 |
| Coordinates | 10493..10876 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A1Z1SPN9 |
| Locus tag | ONR68_RS00050 | Protein ID | WP_004246496.1 |
| Coordinates | 10873..11094 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR68_RS00025 (ONR68_00025) | 6128..7234 | - | 1107 | WP_004249769.1 | aspartate-semialdehyde dehydrogenase | - |
| ONR68_RS00030 (ONR68_00030) | 7734..8297 | + | 564 | WP_012368640.1 | rRNA adenine N-6-methyltransferase family protein | - |
| ONR68_RS00035 (ONR68_00035) | 8573..9472 | + | 900 | WP_004246500.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| ONR68_RS00040 (ONR68_00040) | 9772..10086 | - | 315 | WP_004246498.1 | helix-turn-helix transcriptional regulator | - |
| ONR68_RS00045 (ONR68_00045) | 10493..10876 | - | 384 | WP_049194960.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| ONR68_RS00050 (ONR68_00050) | 10873..11094 | - | 222 | WP_004246496.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| ONR68_RS00055 (ONR68_00055) | 11698..11988 | + | 291 | WP_196561058.1 | helix-turn-helix transcriptional regulator | - |
| ONR68_RS00060 (ONR68_00060) | 11978..13327 | + | 1350 | WP_196561054.1 | type II toxin-antitoxin system HipA family toxin | - |
| ONR68_RS00065 (ONR68_00065) | 13346..14350 | + | 1005 | WP_191901693.1 | SEC-C domain-containing protein | - |
| ONR68_RS00070 (ONR68_00070) | 14478..15476 | + | 999 | WP_251106115.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14462.43 Da Isoelectric Point: 6.6451
>T263770 WP_049194960.1 NZ_CP110376:c10876-10493 [Proteus mirabilis]
MIWVSAQEVIAFHDRILQHFPGVAGMSDPGRAEALIYRVQNRKHDEGITDVFELAATYWVAIARGHIFNDGNKRTAFFVT
MTFLYRNGIRIRDTDNMLENLTVEAATGEKTVDQLAKHLQNLVEKTN
MIWVSAQEVIAFHDRILQHFPGVAGMSDPGRAEALIYRVQNRKHDEGITDVFELAATYWVAIARGHIFNDGNKRTAFFVT
MTFLYRNGIRIRDTDNMLENLTVEAATGEKTVDQLAKHLQNLVEKTN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|