Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1887505..1888304 | Replicon | chromosome |
| Accession | NZ_CP110375 | ||
| Organism | Proteus mirabilis strain NYP6 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | A0A8E3RD10 |
| Locus tag | ONR69_RS09155 | Protein ID | WP_004247966.1 |
| Coordinates | 1887780..1888304 (+) | Length | 175 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | B4EVS2 |
| Locus tag | ONR69_RS09150 | Protein ID | WP_004247964.1 |
| Coordinates | 1887505..1887783 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR69_RS09125 (ONR69_09125) | 1882855..1883937 | + | 1083 | WP_004242680.1 | peptide chain release factor 1 | - |
| ONR69_RS09130 (ONR69_09130) | 1883937..1884785 | + | 849 | WP_004251398.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| ONR69_RS09135 (ONR69_09135) | 1884763..1885578 | + | 816 | WP_004242688.1 | invasion regulator SirB1 | - |
| ONR69_RS09140 (ONR69_09140) | 1885636..1886490 | + | 855 | WP_004242689.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| ONR69_RS09145 (ONR69_09145) | 1886498..1887427 | + | 930 | WP_004242691.1 | TIGR01212 family radical SAM protein | - |
| ONR69_RS09150 (ONR69_09150) | 1887505..1887783 | + | 279 | WP_004247964.1 | DUF1778 domain-containing protein | Antitoxin |
| ONR69_RS09155 (ONR69_09155) | 1887780..1888304 | + | 525 | WP_004247966.1 | hypothetical protein | Toxin |
| ONR69_RS09160 (ONR69_09160) | 1888385..1890085 | - | 1701 | WP_004247967.1 | C4-dicarboxylic acid transporter DauA | - |
| ONR69_RS09170 (ONR69_09170) | 1891049..1891990 | + | 942 | WP_004242695.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19192.12 Da Isoelectric Point: 9.3561
>T263767 WP_004247966.1 NZ_CP110375:1887780-1888304 [Proteus mirabilis]
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|