Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1556684..1557329 | Replicon | chromosome |
| Accession | NZ_CP110375 | ||
| Organism | Proteus mirabilis strain NYP6 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B4ET86 |
| Locus tag | ONR69_RS07320 | Protein ID | WP_004247035.1 |
| Coordinates | 1557144..1557329 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | B4ET85 |
| Locus tag | ONR69_RS07315 | Protein ID | WP_004247034.1 |
| Coordinates | 1556684..1557097 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR69_RS07285 (ONR69_07285) | 1552231..1552389 | - | 159 | WP_004247025.1 | hypothetical protein | - |
| ONR69_RS07290 (ONR69_07290) | 1552841..1553017 | + | 177 | WP_004247026.1 | hypothetical protein | - |
| ONR69_RS07295 (ONR69_07295) | 1553194..1553940 | - | 747 | Protein_1403 | methyltransferase domain-containing protein | - |
| ONR69_RS07300 (ONR69_07300) | 1554790..1555368 | + | 579 | WP_004247030.1 | alpha/beta hydrolase | - |
| ONR69_RS07305 (ONR69_07305) | 1555481..1555723 | - | 243 | WP_230458803.1 | hypothetical protein | - |
| ONR69_RS07310 (ONR69_07310) | 1556088..1556588 | - | 501 | WP_041707083.1 | response regulator | - |
| ONR69_RS07315 (ONR69_07315) | 1556684..1557097 | - | 414 | WP_004247034.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| ONR69_RS07320 (ONR69_07320) | 1557144..1557329 | - | 186 | WP_004247035.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| ONR69_RS07325 (ONR69_07325) | 1557405..1557902 | + | 498 | WP_223852280.1 | DUF1073 domain-containing protein | - |
| ONR69_RS07330 (ONR69_07330) | 1557845..1558213 | + | 369 | WP_223232026.1 | DUF1073 domain-containing protein | - |
| ONR69_RS07335 (ONR69_07335) | 1558216..1558434 | + | 219 | Protein_1411 | hypothetical protein | - |
| ONR69_RS07340 (ONR69_07340) | 1558999..1559319 | - | 321 | WP_223307228.1 | PH domain-containing protein | - |
| ONR69_RS07345 (ONR69_07345) | 1559383..1559697 | - | 315 | WP_135091643.1 | hypothetical protein | - |
| ONR69_RS07350 (ONR69_07350) | 1560297..1561313 | - | 1017 | WP_049257338.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1550547..1610860 | 60313 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7049.30 Da Isoelectric Point: 10.9659
>T263766 WP_004247035.1 NZ_CP110375:c1557329-1557144 [Proteus mirabilis]
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN
MKSSELIKLLEKNGWILDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQIIKSAKLKN
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15251.98 Da Isoelectric Point: 4.3830
>AT263766 WP_004247034.1 NZ_CP110375:c1557097-1556684 [Proteus mirabilis]
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADARSAIDAHFELLSEKGLDIPSPKSQQEHLINSSGDYNNGIWL
LVDVDMDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|