Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-HipB |
Location | 4047637..4048248 | Replicon | chromosome |
Accession | NZ_CP110373 | ||
Organism | Proteus mirabilis strain CZP26 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | ONR66_RS18775 | Protein ID | WP_237075908.1 |
Coordinates | 4047637..4047990 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | B4F0T9 |
Locus tag | ONR66_RS18780 | Protein ID | WP_004249771.1 |
Coordinates | 4047991..4048248 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONR66_RS18755 (ONR66_18755) | 4042870..4043673 | + | 804 | WP_049220158.1 | energy transducer TonB | - |
ONR66_RS18760 (ONR66_18760) | 4043727..4045688 | - | 1962 | WP_012368635.1 | insecticidal delta-endotoxin Cry8Ea1 family protein | - |
ONR66_RS18765 (ONR66_18765) | 4045720..4046649 | - | 930 | WP_004246518.1 | metallophosphoesterase | - |
ONR66_RS18770 (ONR66_18770) | 4046834..4047298 | - | 465 | WP_012368636.1 | DUF1097 domain-containing protein | - |
ONR66_RS18775 (ONR66_18775) | 4047637..4047990 | - | 354 | WP_237075908.1 | HipA N-terminal domain-containing protein | Toxin |
ONR66_RS18780 (ONR66_18780) | 4047991..4048248 | - | 258 | WP_004249771.1 | helix-turn-helix domain-containing protein | Antitoxin |
ONR66_RS18785 (ONR66_18785) | 4048397..4049761 | - | 1365 | WP_004246513.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
ONR66_RS18790 (ONR66_18790) | 4049899..4051539 | - | 1641 | WP_004246512.1 | membrane protein insertase YidC | - |
ONR66_RS18795 (ONR66_18795) | 4051542..4051802 | - | 261 | WP_012368639.1 | membrane protein insertion efficiency factor YidD | - |
ONR66_RS18800 (ONR66_18800) | 4051766..4052125 | - | 360 | WP_004246510.1 | ribonuclease P protein component | - |
ONR66_RS18805 (ONR66_18805) | 4052143..4052286 | - | 144 | WP_004246509.1 | 50S ribosomal protein L34 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13114.70 Da Isoelectric Point: 4.5238
>T263764 WP_237075908.1 NZ_CP110373:c4047990-4047637 [Proteus mirabilis]
MASLDVYMNEYYVGIFTKKSSGAHSFQYTEDWVNQPGSRPISLSMPLQLQEYQGDCVYNFFDNLLPDNTEIRNRIVSRYN
ANSNQPFDLLAAIGADTVGALRLLPSGSTPADIKKIE
MASLDVYMNEYYVGIFTKKSSGAHSFQYTEDWVNQPGSRPISLSMPLQLQEYQGDCVYNFFDNLLPDNTEIRNRIVSRYN
ANSNQPFDLLAAIGADTVGALRLLPSGSTPADIKKIE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|