Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 3739484..3740133 | Replicon | chromosome |
Accession | NZ_CP110373 | ||
Organism | Proteus mirabilis strain CZP26 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B4EZB9 |
Locus tag | ONR66_RS17390 | Protein ID | WP_012368534.1 |
Coordinates | 3739484..3739903 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B4EZC0 |
Locus tag | ONR66_RS17395 | Protein ID | WP_012368535.1 |
Coordinates | 3739900..3740133 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONR66_RS17360 (ONR66_17360) | 3735490..3736404 | - | 915 | WP_004249085.1 | fatty acid biosynthesis protein FabY | - |
ONR66_RS17365 (ONR66_17365) | 3736428..3736865 | - | 438 | WP_004246810.1 | D-aminoacyl-tRNA deacylase | - |
ONR66_RS17370 (ONR66_17370) | 3736946..3737563 | - | 618 | WP_020946398.1 | glucose-1-phosphatase | - |
ONR66_RS17375 (ONR66_17375) | 3737905..3738213 | - | 309 | WP_004246808.1 | helix-turn-helix transcriptional regulator | - |
ONR66_RS17380 (ONR66_17380) | 3738542..3738958 | - | 417 | WP_049196823.1 | hypothetical protein | - |
ONR66_RS17385 (ONR66_17385) | 3738936..3739259 | - | 324 | WP_012368533.1 | hypothetical protein | - |
ONR66_RS17390 (ONR66_17390) | 3739484..3739903 | - | 420 | WP_012368534.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ONR66_RS17395 (ONR66_17395) | 3739900..3740133 | - | 234 | WP_012368535.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ONR66_RS17400 (ONR66_17400) | 3740401..3740553 | + | 153 | WP_167552341.1 | hypothetical protein | - |
ONR66_RS17405 (ONR66_17405) | 3740884..3742719 | - | 1836 | WP_004246802.1 | ribosome-dependent GTPase TypA | - |
ONR66_RS17410 (ONR66_17410) | 3743079..3744488 | + | 1410 | WP_004246801.1 | glutamate--ammonia ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15371.88 Da Isoelectric Point: 7.7288
>T263763 WP_012368534.1 NZ_CP110373:c3739903-3739484 [Proteus mirabilis]
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|