Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-MqsA |
Location | 3718056..3718755 | Replicon | chromosome |
Accession | NZ_CP110373 | ||
Organism | Proteus mirabilis strain CZP26 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | ONR66_RS17275 | Protein ID | WP_163806902.1 |
Coordinates | 3718056..3718442 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B4EZ97 |
Locus tag | ONR66_RS17280 | Protein ID | WP_004246828.1 |
Coordinates | 3718435..3718755 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONR66_RS17260 (ONR66_17260) | 3714075..3714656 | - | 582 | WP_020946389.1 | DNA-3-methyladenine glycosylase I | - |
ONR66_RS17265 (ONR66_17265) | 3714907..3715812 | + | 906 | WP_004246832.1 | glycine--tRNA ligase subunit alpha | - |
ONR66_RS17270 (ONR66_17270) | 3715822..3717894 | + | 2073 | WP_041701373.1 | glycine--tRNA ligase subunit beta | - |
ONR66_RS17275 (ONR66_17275) | 3718056..3718442 | + | 387 | WP_163806902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ONR66_RS17280 (ONR66_17280) | 3718435..3718755 | + | 321 | WP_004246828.1 | helix-turn-helix domain-containing protein | Antitoxin |
ONR66_RS17285 (ONR66_17285) | 3718804..3719238 | - | 435 | WP_036972158.1 | hypothetical protein | - |
ONR66_RS17290 (ONR66_17290) | 3719231..3720115 | - | 885 | WP_012368526.1 | endonuclease/exonuclease/phosphatase family protein | - |
ONR66_RS17295 (ONR66_17295) | 3720333..3721619 | - | 1287 | WP_049220287.1 | DUF3748 domain-containing protein | - |
ONR66_RS17300 (ONR66_17300) | 3721756..3722373 | + | 618 | WP_004246822.1 | trimeric intracellular cation channel family protein | - |
ONR66_RS17305 (ONR66_17305) | 3722675..3723298 | + | 624 | WP_004246821.1 | guanylate kinase | - |
ONR66_RS17310 (ONR66_17310) | 3723353..3723628 | + | 276 | WP_004246820.1 | DNA-directed RNA polymerase subunit omega | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14322.69 Da Isoelectric Point: 10.0642
>T263762 WP_163806902.1 NZ_CP110373:3718056-3718442 [Proteus mirabilis]
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNVNQNKIDKMIALGLLTEVKYD
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNVNQNKIDKMIALGLLTEVKYD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|