Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 14598..15199 Replicon chromosome
Accession NZ_CP110373
Organism Proteus mirabilis strain CZP26

Toxin (Protein)


Gene name doc Uniprot ID A0A2X2BIG8
Locus tag ONR66_RS00065 Protein ID WP_004246497.1
Coordinates 14598..14981 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A1Z1SPN9
Locus tag ONR66_RS00070 Protein ID WP_004246496.1
Coordinates 14978..15199 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ONR66_RS00040 (ONR66_00040) 9971..10429 + 459 WP_004249766.1 GNAT family N-acetyltransferase -
ONR66_RS00045 (ONR66_00045) 10525..11262 - 738 WP_004249950.1 tetratricopeptide repeat protein -
ONR66_RS00050 (ONR66_00050) 11371..12270 + 900 WP_112843219.1 N-acetylmuramic acid 6-phosphate etherase -
ONR66_RS00055 (ONR66_00055) 12627..13865 - 1239 WP_020946511.1 HipA domain-containing protein -
ONR66_RS00060 (ONR66_00060) 13878..14192 - 315 WP_004246498.1 helix-turn-helix transcriptional regulator -
ONR66_RS00065 (ONR66_00065) 14598..14981 - 384 WP_004246497.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
ONR66_RS00070 (ONR66_00070) 14978..15199 - 222 WP_004246496.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
ONR66_RS00075 (ONR66_00075) 15480..16343 - 864 WP_004249947.1 YicC/YloC family endoribonuclease -
ONR66_RS00080 (ONR66_00080) 16470..17186 + 717 WP_004249760.1 ribonuclease PH -
ONR66_RS00085 (ONR66_00085) 17268..17912 + 645 WP_004246493.1 orotate phosphoribosyltransferase -
ONR66_RS00090 (ONR66_00090) 18231..18836 - 606 WP_004246491.1 nucleoid occlusion factor SlmA -
ONR66_RS00095 (ONR66_00095) 18956..19414 - 459 WP_004246490.1 dUTP diphosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(5-115)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-52)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14471.53 Da        Isoelectric Point: 8.5125

>T263757 WP_004246497.1 NZ_CP110373:c14981-14598 [Proteus mirabilis]
MIWVSAQEVIAFHDRILQRFPGVAGMSDPGRAEALIYRVQNRKHYEGITDVFELAATYWVAIARGHIFNDGNKRTAFFVT
MTFLYRNGIRIRDTGNMLENLTVEAATGEKTVDQLAKHLQNLVEKTN

Download         Length: 384 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8260.23 Da        Isoelectric Point: 5.5667

>AT263757 WP_004246496.1 NZ_CP110373:c15199-14978 [Proteus mirabilis]
MRTYTSTQARANISEVLDIATHGEPVEITRRDGCSAVVISKTEFESYQNAKLDAEFDMMMQRHGHTVEALTNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2X2BIG8

Antitoxin

Source ID Structure
AlphaFold DB A0A1Z1SPN9

References