Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-MqsA |
Location | 3811750..3812449 | Replicon | chromosome |
Accession | NZ_CP110372 | ||
Organism | Proteus mirabilis strain CZP44 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B4EZ96 |
Locus tag | ONR64_RS17505 | Protein ID | WP_004249093.1 |
Coordinates | 3812063..3812449 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B4EZ97 |
Locus tag | ONR64_RS17500 | Protein ID | WP_004246828.1 |
Coordinates | 3811750..3812070 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONR64_RS17470 (ONR64_17470) | 3806878..3807153 | - | 276 | WP_004246820.1 | DNA-directed RNA polymerase subunit omega | - |
ONR64_RS17475 (ONR64_17475) | 3807208..3807831 | - | 624 | WP_004246821.1 | guanylate kinase | - |
ONR64_RS17480 (ONR64_17480) | 3808133..3808750 | - | 618 | WP_004246822.1 | trimeric intracellular cation channel family protein | - |
ONR64_RS17485 (ONR64_17485) | 3808887..3810173 | + | 1287 | WP_049256516.1 | DUF3748 domain-containing protein | - |
ONR64_RS17490 (ONR64_17490) | 3810390..3811274 | + | 885 | WP_004249091.1 | endonuclease/exonuclease/phosphatase family protein | - |
ONR64_RS17495 (ONR64_17495) | 3811267..3811701 | + | 435 | WP_004246827.1 | hypothetical protein | - |
ONR64_RS17500 (ONR64_17500) | 3811750..3812070 | - | 321 | WP_004246828.1 | helix-turn-helix domain-containing protein | Antitoxin |
ONR64_RS17505 (ONR64_17505) | 3812063..3812449 | - | 387 | WP_004249093.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ONR64_RS17510 (ONR64_17510) | 3812611..3814683 | - | 2073 | WP_004246830.1 | glycine--tRNA ligase subunit beta | - |
ONR64_RS17515 (ONR64_17515) | 3814693..3815598 | - | 906 | WP_004246832.1 | glycine--tRNA ligase subunit alpha | - |
ONR64_RS17520 (ONR64_17520) | 3815849..3816430 | + | 582 | WP_004246833.1 | DNA-3-methyladenine glycosylase I | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14294.64 Da Isoelectric Point: 10.0642
>T263756 WP_004249093.1 NZ_CP110372:c3812449-3812063 [Proteus mirabilis]
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|