Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 3433709..3434310 | Replicon | chromosome |
| Accession | NZ_CP110372 | ||
| Organism | Proteus mirabilis strain CZP44 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A2X2BIG8 |
| Locus tag | ONR64_RS15775 | Protein ID | WP_004246497.1 |
| Coordinates | 3433927..3434310 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A1Z1SPN9 |
| Locus tag | ONR64_RS15770 | Protein ID | WP_004246496.1 |
| Coordinates | 3433709..3433930 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR64_RS15745 (ONR64_15745) | 3429494..3429952 | + | 459 | WP_004246490.1 | dUTP diphosphatase | - |
| ONR64_RS15750 (ONR64_15750) | 3430072..3430677 | + | 606 | WP_004246491.1 | nucleoid occlusion factor SlmA | - |
| ONR64_RS15755 (ONR64_15755) | 3430996..3431640 | - | 645 | WP_004246493.1 | orotate phosphoribosyltransferase | - |
| ONR64_RS15760 (ONR64_15760) | 3431722..3432438 | - | 717 | WP_004249760.1 | ribonuclease PH | - |
| ONR64_RS15765 (ONR64_15765) | 3432565..3433428 | + | 864 | WP_004249947.1 | YicC/YloC family endoribonuclease | - |
| ONR64_RS15770 (ONR64_15770) | 3433709..3433930 | + | 222 | WP_004246496.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| ONR64_RS15775 (ONR64_15775) | 3433927..3434310 | + | 384 | WP_004246497.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| ONR64_RS15780 (ONR64_15780) | 3434718..3435032 | + | 315 | WP_004246498.1 | helix-turn-helix transcriptional regulator | - |
| ONR64_RS15785 (ONR64_15785) | 3435332..3436231 | - | 900 | WP_004246500.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| ONR64_RS15790 (ONR64_15790) | 3436507..3437070 | - | 564 | WP_012368640.1 | rRNA adenine N-6-methyltransferase family protein | - |
| ONR64_RS15795 (ONR64_15795) | 3437570..3438676 | + | 1107 | WP_060555875.1 | aspartate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14471.53 Da Isoelectric Point: 8.5125
>T263754 WP_004246497.1 NZ_CP110372:3433927-3434310 [Proteus mirabilis]
MIWVSAQEVIAFHDRILQRFPGVAGMSDPGRAEALIYRVQNRKHYEGITDVFELAATYWVAIARGHIFNDGNKRTAFFVT
MTFLYRNGIRIRDTGNMLENLTVEAATGEKTVDQLAKHLQNLVEKTN
MIWVSAQEVIAFHDRILQRFPGVAGMSDPGRAEALIYRVQNRKHYEGITDVFELAATYWVAIARGHIFNDGNKRTAFFVT
MTFLYRNGIRIRDTGNMLENLTVEAATGEKTVDQLAKHLQNLVEKTN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2X2BIG8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Z1SPN9 |