Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2486488..2487320 Replicon chromosome
Accession NZ_CP110372
Organism Proteus mirabilis strain CZP44

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag ONR64_RS11420 Protein ID WP_000854753.1
Coordinates 2486946..2487320 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID E3PJ72
Locus tag ONR64_RS11415 Protein ID WP_001278232.1
Coordinates 2486488..2486856 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ONR64_RS11385 (ONR64_11385) 2483324..2483779 + 456 WP_072645706.1 IrmA family protein -
ONR64_RS11390 (ONR64_11390) 2483858..2484091 + 234 WP_001119729.1 DUF905 family protein -
ONR64_RS11395 (ONR64_11395) 2484191..2485009 + 819 WP_001234620.1 DUF932 domain-containing protein -
ONR64_RS11400 (ONR64_11400) 2485064..2485549 + 486 WP_000849582.1 antirestriction protein -
ONR64_RS11405 (ONR64_11405) 2485565..2486041 + 477 WP_001186726.1 RadC family protein -
ONR64_RS11410 (ONR64_11410) 2486104..2486325 + 222 WP_000692329.1 DUF987 domain-containing protein -
ONR64_RS11415 (ONR64_11415) 2486488..2486856 + 369 WP_001278232.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
ONR64_RS11420 (ONR64_11420) 2486946..2487320 + 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
ONR64_RS11425 (ONR64_11425) 2487317..2487805 + 489 WP_000777545.1 DUF5983 family protein -
ONR64_RS11430 (ONR64_11430) 2487772..2488014 + 243 WP_001317562.1 DUF957 domain-containing protein -
ONR64_RS11435 (ONR64_11435) 2488111..2488683 + 573 WP_001290246.1 DUF4942 domain-containing protein -
ONR64_RS11440 (ONR64_11440) 2489091..2489390 - 300 WP_104459494.1 helix-turn-helix domain-containing protein -
ONR64_RS11445 (ONR64_11445) 2489392..2489742 - 351 Protein_2225 type II toxin-antitoxin system RelE/ParE family toxin -
ONR64_RS11450 (ONR64_11450) 2489988..2490758 + 771 WP_104459493.1 phosphoribosyltransferase -
ONR64_RS11455 (ONR64_11455) 2491874..2491981 + 108 WP_107034653.1 leader peptide SpeFL -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2449892..2489742 39850


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T263753 WP_000854753.1 NZ_CP110372:2486946-2487320 [Proteus mirabilis]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13491.37 Da        Isoelectric Point: 6.6290

>AT263753 WP_001278232.1 NZ_CP110372:2486488-2486856 [Proteus mirabilis]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB E3PJ72

References