Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4036025..4036626 Replicon chromosome
Accession NZ_CP110371
Organism Proteus mirabilis strain CZP17

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag ONR70_RS18545 Protein ID WP_049196622.1
Coordinates 4036243..4036626 (+) Length 128 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A1Z1SPN9
Locus tag ONR70_RS18540 Protein ID WP_004246496.1
Coordinates 4036025..4036246 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ONR70_RS18515 (ONR70_18515) 4031810..4032268 + 459 WP_004246490.1 dUTP diphosphatase -
ONR70_RS18520 (ONR70_18520) 4032388..4032993 + 606 WP_004246491.1 nucleoid occlusion factor SlmA -
ONR70_RS18525 (ONR70_18525) 4033312..4033956 - 645 WP_060557242.1 orotate phosphoribosyltransferase -
ONR70_RS18530 (ONR70_18530) 4034038..4034754 - 717 WP_004249760.1 ribonuclease PH -
ONR70_RS18535 (ONR70_18535) 4034881..4035744 + 864 WP_060557243.1 YicC/YloC family endoribonuclease -
ONR70_RS18540 (ONR70_18540) 4036025..4036246 + 222 WP_004246496.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
ONR70_RS18545 (ONR70_18545) 4036243..4036626 + 384 WP_049196622.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
ONR70_RS18550 (ONR70_18550) 4036787..4037686 - 900 WP_063108742.1 N-acetylmuramic acid 6-phosphate etherase -
ONR70_RS18555 (ONR70_18555) 4037795..4038532 + 738 WP_004249950.1 tetratricopeptide repeat protein -
ONR70_RS18560 (ONR70_18560) 4038628..4039086 - 459 WP_150452832.1 GNAT family N-acetyltransferase -
ONR70_RS18565 (ONR70_18565) 4039215..4040702 + 1488 WP_150452831.1 PLP-dependent aminotransferase family protein -
ONR70_RS18570 (ONR70_18570) 4040758..4041327 - 570 WP_004249768.1 rRNA adenine N-6-methyltransferase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron aac(6')-Ib-cr / blaOXA-1 / ARR-3 / qacE / aadA17 / sul1 / catB3 rpe / hcp / tufA / htpB / rfaE / lpxC / rtxH / algU / katA / rcsB / flhD / flhC / motA / cheA / cheW / cheB / cheY / cheZ / flhA / flgB / flgC / flgG / flgH / flgI / fliQ / fliP / fliN / fliM / fliI / fliG / fliA / gtrB / galU / sodB / hcp / kdsA / flmH / ompA / hcp / tssB / AHA_1833 / nueA / msbA / allD / gnd / luxS / gmhA/lpcA / acrB / wbtL / tufA / ugd / rfaD 3..4134675 4134672


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(3-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-52)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14529.57 Da        Isoelectric Point: 7.4005

>T263749 WP_049196622.1 NZ_CP110371:4036243-4036626 [Proteus mirabilis]
MIWVSAQEVIAFHDRILQRFPGVAGMSDPGRAEALIYRVQNRKHYEGITDVFELAATYWVAIARGHIFNDGNKRTAFFVT
MTFLYRNGIRIRDTDNMLENLTVEAATGEKTVDQLAKHLQNLVEKTN

Download         Length: 384 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8260.23 Da        Isoelectric Point: 5.5667

>AT263749 WP_004246496.1 NZ_CP110371:4036025-4036246 [Proteus mirabilis]
MRTYTSTQARANISEVLDIATHGEPVEITRRDGCSAVVISKTEFESYQNAKLDAEFDMMMQRHGHTVEALTNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1Z1SPN9

References