Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 287069..287718 Replicon chromosome
Accession NZ_CP110371
Organism Proteus mirabilis strain CZP17

Toxin (Protein)


Gene name vagD Uniprot ID B4EZB9
Locus tag ONR70_RS01290 Protein ID WP_012368534.1
Coordinates 287299..287718 (+) Length 140 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B4EZC0
Locus tag ONR70_RS01285 Protein ID WP_012368535.1
Coordinates 287069..287302 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ONR70_RS01260 (ONR70_01260) 282780..283259 - 480 WP_060555753.1 Hcp family type VI secretion system effector -
ONR70_RS01265 (ONR70_01265) 283709..283996 - 288 WP_104731871.1 transposase -
ONR70_RS01270 (ONR70_01270) 284044..284265 + 222 WP_060555751.1 hypothetical protein -
ONR70_RS01275 (ONR70_01275) 284482..285690 - 1209 WP_060555750.1 DUF262 domain-containing protein -
ONR70_RS01280 (ONR70_01280) 286650..286802 - 153 WP_172764486.1 hypothetical protein -
ONR70_RS01285 (ONR70_01285) 287069..287302 + 234 WP_012368535.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ONR70_RS01290 (ONR70_01290) 287299..287718 + 420 WP_012368534.1 type II toxin-antitoxin system VapC family toxin Toxin
ONR70_RS01295 (ONR70_01295) 287943..288266 + 324 WP_104731870.1 hypothetical protein -
ONR70_RS01300 (ONR70_01300) 288244..288660 + 417 WP_046334846.1 hypothetical protein -
ONR70_RS01305 (ONR70_01305) 289312..289929 + 618 WP_004246809.1 glucose-1-phosphatase -
ONR70_RS01310 (ONR70_01310) 290010..290447 + 438 WP_004246810.1 D-aminoacyl-tRNA deacylase -
ONR70_RS01315 (ONR70_01315) 290471..291385 + 915 WP_004249085.1 fatty acid biosynthesis protein FabY -
ONR70_RS01320 (ONR70_01320) 291561..292439 + 879 WP_017628653.1 23S rRNA pseudouridine(2604) synthase RluF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron aac(6')-Ib-cr / blaOXA-1 / ARR-3 / qacE / aadA17 / sul1 / catB3 rpe / hcp / tufA / htpB / rfaE / lpxC / rtxH / algU / katA / rcsB / flhD / flhC / motA / cheA / cheW / cheB / cheY / cheZ / flhA / flgB / flgC / flgG / flgH / flgI / fliQ / fliP / fliN / fliM / fliI / fliG / fliA / gtrB / galU / sodB / hcp / kdsA / flmH / ompA / hcp / tssB / AHA_1833 / nueA / msbA / allD / gnd / luxS / gmhA/lpcA / acrB / wbtL / tufA / ugd / rfaD 3..4134675 4134672


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(9-56)


Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 15371.88 Da        Isoelectric Point: 7.7288

>T263747 WP_012368534.1 NZ_CP110371:287299-287718 [Proteus mirabilis]
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV

Download         Length: 420 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8890.06 Da        Isoelectric Point: 4.4870

>AT263747 WP_012368535.1 NZ_CP110371:287069-287302 [Proteus mirabilis]
MRTRTVAVFKNGSNRAIRLPKDFDFDGVNELEISRDGDCIILRPVKPNWISLQNEEKADSDFLLERDDVIEEGRVIL

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB B4EZB9

Antitoxin

Source ID Structure
AlphaFold DB B4EZC0

References