Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4683546..4684350 | Replicon | chromosome |
| Accession | NZ_CP110369 | ||
| Organism | Klebsiella pneumoniae isolate KP7626 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A486SQP3 |
| Locus tag | OM094_RS22915 | Protein ID | WP_040217122.1 |
| Coordinates | 4683546..4683935 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7H4M120 |
| Locus tag | OM094_RS22920 | Protein ID | WP_014837280.1 |
| Coordinates | 4683991..4684350 (-) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM094_RS22900 (4680128) | 4680128..4681381 | - | 1254 | WP_044784988.1 | integrase arm-type DNA-binding domain-containing protein | - |
| OM094_RS22905 (4681675) | 4681675..4682472 | - | 798 | WP_014837283.1 | helix-turn-helix transcriptional regulator | - |
| OM094_RS22910 (4682614) | 4682614..4683459 | - | 846 | WP_014837282.1 | DUF4942 domain-containing protein | - |
| OM094_RS22915 (4683546) | 4683546..4683935 | - | 390 | WP_040217122.1 | TA system toxin CbtA family protein | Toxin |
| OM094_RS22920 (4683991) | 4683991..4684350 | - | 360 | WP_014837280.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OM094_RS22925 (4684375) | 4684375..4684596 | - | 222 | WP_014837279.1 | DUF987 domain-containing protein | - |
| OM094_RS22930 (4684610) | 4684610..4685089 | - | 480 | WP_014837278.1 | DNA repair protein RadC | - |
| OM094_RS22935 (4685101) | 4685101..4685544 | - | 444 | WP_014837277.1 | antirestriction protein | - |
| OM094_RS22940 (4685624) | 4685624..4685854 | - | 231 | WP_014837276.1 | DUF905 domain-containing protein | - |
| OM094_RS22945 (4685878) | 4685878..4686702 | - | 825 | WP_040217125.1 | DUF932 domain-containing protein | - |
| OM094_RS22950 (4687242) | 4687242..4687637 | + | 396 | Protein_4502 | inovirus Gp2 family protein | - |
| OM094_RS22960 (4689019) | 4689019..4689210 | + | 192 | WP_265083997.1 | inovirus Gp2 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4661351..4694715 | 33364 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14477.57 Da Isoelectric Point: 8.9843
>T263742 WP_040217122.1 NZ_CP110369:c4683935-4683546 [Klebsiella pneumoniae]
MQTKSPPFMRAASSRPSPVGVWQTLLTCLLEHHYGLTLNDTPFSDELVIQQHIEAGISLADALNFIVEKYELVRTDRPGF
SIREQSPFITSIDILRARKATGLMNRDTYKEVTAITRGQHPQVSAPGKR
MQTKSPPFMRAASSRPSPVGVWQTLLTCLLEHHYGLTLNDTPFSDELVIQQHIEAGISLADALNFIVEKYELVRTDRPGF
SIREQSPFITSIDILRARKATGLMNRDTYKEVTAITRGQHPQVSAPGKR
Download Length: 390 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13416.24 Da Isoelectric Point: 7.0268
>AT263742 WP_014837280.1 NZ_CP110369:c4684350-4683991 [Klebsiella pneumoniae]
MSKKTTIATHDISESWWGLRRSVSACFGARLVQEGNRLHYLADRANFNGQFCDADLRHLDQSFPVLMKQLELMLTSGELN
PRHQHCVTLYAKGLTCEADTLGSHGYVYIAIYPTPVTTE
MSKKTTIATHDISESWWGLRRSVSACFGARLVQEGNRLHYLADRANFNGQFCDADLRHLDQSFPVLMKQLELMLTSGELN
PRHQHCVTLYAKGLTCEADTLGSHGYVYIAIYPTPVTTE
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A486SQP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H4M120 |