Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4035603..4036222 Replicon chromosome
Accession NZ_CP110369
Organism Klebsiella pneumoniae isolate KP7626

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OM094_RS19780 Protein ID WP_002892050.1
Coordinates 4036004..4036222 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OM094_RS19775 Protein ID WP_002892066.1
Coordinates 4035603..4035977 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM094_RS19765 (4030755) 4030755..4031948 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OM094_RS19770 (4031971) 4031971..4035117 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OM094_RS19775 (4035603) 4035603..4035977 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OM094_RS19780 (4036004) 4036004..4036222 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OM094_RS19785 (4036381) 4036381..4036947 + 567 WP_002892030.1 maltose O-acetyltransferase -
OM094_RS19790 (4036919) 4036919..4037059 - 141 WP_004147370.1 hypothetical protein -
OM094_RS19795 (4037080) 4037080..4037550 + 471 WP_002892026.1 YlaC family protein -
OM094_RS19800 (4037525) 4037525..4038976 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OM094_RS19805 (4039077) 4039077..4039775 + 699 WP_002892021.1 GNAT family protein -
OM094_RS19810 (4039772) 4039772..4039912 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OM094_RS19815 (4039912) 4039912..4040175 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263740 WP_002892050.1 NZ_CP110369:4036004-4036222 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263740 WP_002892066.1 NZ_CP110369:4035603-4035977 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References