Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1772728..1773318 | Replicon | chromosome |
Accession | NZ_CP110369 | ||
Organism | Klebsiella pneumoniae isolate KP7626 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | OM094_RS08620 | Protein ID | WP_023341911.1 |
Coordinates | 1772986..1773318 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A3S7DDD0 |
Locus tag | OM094_RS08615 | Protein ID | WP_000288812.1 |
Coordinates | 1772728..1772985 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM094_RS08590 (1768638) | 1768638..1768712 | + | 75 | Protein_1682 | type II toxin-antitoxin system PemK/MazF family toxin | - |
OM094_RS08595 (1769063) | 1769063..1770811 | + | 1749 | WP_032418698.1 | hypothetical protein | - |
OM094_RS08600 (1770865) | 1770865..1771446 | + | 582 | WP_099184326.1 | hypothetical protein | - |
OM094_RS08605 (1771729) | 1771729..1772190 | + | 462 | WP_004213450.1 | hypothetical protein | - |
OM094_RS08610 (1772187) | 1772187..1772393 | + | 207 | WP_020805021.1 | helix-turn-helix transcriptional regulator | - |
OM094_RS08615 (1772728) | 1772728..1772985 | + | 258 | WP_000288812.1 | antitoxin | Antitoxin |
OM094_RS08620 (1772986) | 1772986..1773318 | + | 333 | WP_023341911.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OM094_RS08630 (1773640) | 1773640..1775076 | + | 1437 | WP_004151469.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
OM094_RS08640 (1775442) | 1775442..1776896 | - | 1455 | WP_004148975.1 | AMP nucleosidase | - |
OM094_RS08645 (1777026) | 1777026..1777271 | - | 246 | WP_004141189.1 | signal transduction protein PmrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11927.87 Da Isoelectric Point: 10.4722
>T263733 WP_023341911.1 NZ_CP110369:1772986-1773318 [Klebsiella pneumoniae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARKGKRLERIPDVVVNEVLARLDAMLS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|