Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1317818..1318734 | Replicon | chromosome |
Accession | NZ_CP110365 | ||
Organism | Bacillus subtilis strain HY2-62 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | LFL98_RS06960 | Protein ID | WP_277737090.1 |
Coordinates | 1317988..1318734 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | LFL98_RS06955 | Protein ID | WP_003232646.1 |
Coordinates | 1317818..1317988 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LFL98_RS06920 (LFL98_06925) | 1314681..1315010 | + | 330 | WP_003232660.1 | XkdW family protein | - |
LFL98_RS06925 (LFL98_06930) | 1315007..1315171 | + | 165 | WP_015715740.1 | XkdX family protein | - |
LFL98_RS06930 (LFL98_06935) | 1315215..1316054 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
LFL98_RS06935 (LFL98_06940) | 1316107..1316376 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
LFL98_RS06940 (LFL98_06945) | 1316389..1316652 | + | 264 | WP_003232653.1 | phage holin | - |
LFL98_RS06945 (LFL98_06950) | 1316665..1317558 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
LFL98_RS06950 (LFL98_06955) | 1317595..1317732 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
LFL98_RS06955 (LFL98_06960) | 1317818..1317988 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
LFL98_RS06960 (LFL98_06965) | 1317988..1318734 | - | 747 | WP_277737090.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
LFL98_RS06965 (LFL98_06970) | 1318844..1319845 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
LFL98_RS06970 (LFL98_06975) | 1319858..1320475 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
LFL98_RS06975 (LFL98_06980) | 1320751..1322067 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
LFL98_RS06980 (LFL98_06985) | 1322456..1323406 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
LFL98_RS06985 (LFL98_06990) | 1323507..1323653 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29153.66 Da Isoelectric Point: 4.6191
>T263730 WP_277737090.1 NZ_CP110365:c1318734-1317988 [Bacillus subtilis]
MVLFFQIMVWCIMAGLGLYVYATWRFEAKVKEKMFAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIMAGLGLYVYATWRFEAKVKEKMFAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|