Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 508871..509507 | Replicon | chromosome |
Accession | NZ_CP110365 | ||
Organism | Bacillus subtilis strain HY2-62 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | LFL98_RS02605 | Protein ID | WP_003156187.1 |
Coordinates | 509157..509507 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | LFL98_RS02600 | Protein ID | WP_003225183.1 |
Coordinates | 508871..509152 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LFL98_RS02580 (LFL98_02580) | 505230..505829 | - | 600 | WP_033883543.1 | rhomboid family intramembrane serine protease | - |
LFL98_RS02585 (LFL98_02585) | 505924..506289 | + | 366 | WP_014475874.1 | holo-ACP synthase | - |
LFL98_RS02590 (LFL98_02590) | 506455..507471 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
LFL98_RS02595 (LFL98_02595) | 507586..508755 | + | 1170 | WP_032722929.1 | alanine racemase | - |
LFL98_RS02600 (LFL98_02600) | 508871..509152 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
LFL98_RS02605 (LFL98_02605) | 509157..509507 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
LFL98_RS02610 (LFL98_02610) | 509622..510446 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
LFL98_RS02615 (LFL98_02615) | 510451..510816 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
LFL98_RS02620 (LFL98_02620) | 510820..511221 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
LFL98_RS02625 (LFL98_02625) | 511233..512240 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
LFL98_RS02630 (LFL98_02630) | 512302..512631 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
LFL98_RS02635 (LFL98_02635) | 512628..513110 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
LFL98_RS02640 (LFL98_02640) | 513076..513864 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
LFL98_RS02645 (LFL98_02645) | 513864..514463 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T263729 WP_003156187.1 NZ_CP110365:509157-509507 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|