Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4093243..4093796 | Replicon | chromosome |
| Accession | NZ_CP110362 | ||
| Organism | Dickeya dadantii strain XJ12 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | OL445_RS18425 | Protein ID | WP_284602302.1 |
| Coordinates | 4093482..4093796 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | OL445_RS18420 | Protein ID | WP_284602300.1 |
| Coordinates | 4093243..4093479 (+) | Length | 79 a.a. |
Genomic Context
Location: 4091978..4092922 (945 bp)
Type: Others
Protein ID: WP_284602298.1
Type: Others
Protein ID: WP_284602298.1
Location: 4093243..4093479 (237 bp)
Type: Antitoxin
Protein ID: WP_284602300.1
Type: Antitoxin
Protein ID: WP_284602300.1
Location: 4093482..4093796 (315 bp)
Type: Toxin
Protein ID: WP_284602302.1
Type: Toxin
Protein ID: WP_284602302.1
Location: 4088459..4089136 (678 bp)
Type: Others
Protein ID: WP_284602293.1
Type: Others
Protein ID: WP_284602293.1
Location: 4089149..4090264 (1116 bp)
Type: Others
Protein ID: WP_284602295.1
Type: Others
Protein ID: WP_284602295.1
Location: 4090268..4091326 (1059 bp)
Type: Others
Protein ID: WP_284602297.1
Type: Others
Protein ID: WP_284602297.1
Location: 4093793..4094545 (753 bp)
Type: Others
Protein ID: WP_284602303.1
Type: Others
Protein ID: WP_284602303.1
Location: 4094554..4096290 (1737 bp)
Type: Others
Protein ID: WP_284603812.1
Type: Others
Protein ID: WP_284603812.1
Location: 4097055..4097357 (303 bp)
Type: Others
Protein ID: WP_284602304.1
Type: Others
Protein ID: WP_284602304.1
Location: 4097396..4098412 (1017 bp)
Type: Others
Protein ID: WP_284602305.1
Type: Others
Protein ID: WP_284602305.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OL445_RS18400 | 4088459..4089136 | - | 678 | WP_284602293.1 | hypothetical protein | - |
| OL445_RS18405 | 4089149..4090264 | - | 1116 | WP_284602295.1 | hypothetical protein | - |
| OL445_RS18410 | 4090268..4091326 | - | 1059 | WP_284602297.1 | hypothetical protein | - |
| OL445_RS18415 | 4091978..4092922 | + | 945 | WP_284602298.1 | zincin-like metallopeptidase domain-containing protein | - |
| OL445_RS18420 | 4093243..4093479 | + | 237 | WP_284602300.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| OL445_RS18425 | 4093482..4093796 | + | 315 | WP_284602302.1 | CcdB family protein | Toxin |
| OL445_RS18430 | 4093793..4094545 | - | 753 | WP_284602303.1 | MobC family replication-relaxation protein | - |
| OL445_RS18435 | 4094554..4096290 | - | 1737 | WP_284603812.1 | type IV secretory system conjugative DNA transfer family protein | - |
| OL445_RS18440 | 4097055..4097357 | - | 303 | WP_284602304.1 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| OL445_RS18445 | 4097396..4098412 | - | 1017 | WP_284602305.1 | P-type DNA transfer ATPase VirB11 | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | hcp | 4075366..4131542 | 56176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11542.51 Da Isoelectric Point: 7.9859
>T263722 WP_284602302.1 NZ_CP110362:4093482-4093796 [Dickeya dadantii]
MQFTVYVNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPVEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRNQVKAAIDFLIDGI
MQFTVYVNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPVEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRNQVKAAIDFLIDGI
Download Length: 315 bp