Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | DhiAT/dnstrm_HI1420(antitoxin) |
Location | 3841503..3842257 | Replicon | chromosome |
Accession | NZ_CP110362 | ||
Organism | Dickeya dadantii strain XJ12 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | - |
Locus tag | OL445_RS17310 | Protein ID | WP_033111742.1 |
Coordinates | 3841503..3841760 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | dhiA | Uniprot ID | - |
Locus tag | OL445_RS17315 | Protein ID | WP_077246089.1 |
Coordinates | 3841769..3842257 (+) | Length | 163 a.a. |
Genomic Context
Location: 3841503..3841760 (258 bp)
Type: Toxin
Protein ID: WP_033111742.1
Type: Toxin
Protein ID: WP_033111742.1
Location: 3841769..3842257 (489 bp)
Type: Antitoxin
Protein ID: WP_077246089.1
Type: Antitoxin
Protein ID: WP_077246089.1
Location: 3838265..3840415 (2151 bp)
Type: Others
Protein ID: WP_013317224.1
Type: Others
Protein ID: WP_013317224.1
Location: 3840450..3840992 (543 bp)
Type: Others
Protein ID: WP_013317225.1
Type: Others
Protein ID: WP_013317225.1
Location: 3842333..3842827 (495 bp)
Type: Others
Protein ID: WP_284602148.1
Type: Others
Protein ID: WP_284602148.1
Location: 3842820..3843215 (396 bp)
Type: Others
Protein ID: WP_224062780.1
Type: Others
Protein ID: WP_224062780.1
Location: 3843212..3844003 (792 bp)
Type: Others
Protein ID: WP_161451815.1
Type: Others
Protein ID: WP_161451815.1
Location: 3844000..3844569 (570 bp)
Type: Others
Protein ID: WP_038910722.1
Type: Others
Protein ID: WP_038910722.1
Location: 3844580..3846307 (1728 bp)
Type: Others
Protein ID: WP_284602149.1
Type: Others
Protein ID: WP_284602149.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OL445_RS17300 | 3838265..3840415 | - | 2151 | WP_013317224.1 | formate dehydrogenase subunit alpha | - |
OL445_RS17305 | 3840450..3840992 | - | 543 | WP_013317225.1 | 4Fe-4S dicluster domain-containing protein | - |
OL445_RS17310 | 3841503..3841760 | + | 258 | WP_033111742.1 | DUF4160 domain-containing protein | Toxin |
OL445_RS17315 | 3841769..3842257 | + | 489 | WP_077246089.1 | addiction module antitoxin | Antitoxin |
OL445_RS17320 | 3842333..3842827 | - | 495 | WP_284602148.1 | hydrogenase maturation peptidase HycI | - |
OL445_RS17325 | 3842820..3843215 | - | 396 | WP_224062780.1 | formate hydrogenlyase maturation HycH family protein | - |
OL445_RS17330 | 3843212..3844003 | - | 792 | WP_161451815.1 | NADH-quinone oxidoreductase subunit B family protein | - |
OL445_RS17335 | 3844000..3844569 | - | 570 | WP_038910722.1 | hydrogenase 4 subunit H | - |
OL445_RS17340 | 3844580..3846307 | - | 1728 | WP_284602149.1 | hydrogenase large subunit | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9972.56 Da Isoelectric Point: 7.5550
>T263721 WP_033111742.1 NZ_CP110362:3841503-3841760 [Dickeya dadantii]
MPEIDRLAGLIFYLYFYDDGRHHQPHVHVCYGDDELIIAIDTGIEIEGYLPNSKRKMAIRHINAHRQHLLEMWKLAVKGR
HPGKL
MPEIDRLAGLIFYLYFYDDGRHHQPHVHVCYGDDELIIAIDTGIEIEGYLPNSKRKMAIRHINAHRQHLLEMWKLAVKGR
HPGKL
Download Length: 258 bp
Antitoxin
Download Length: 163 a.a. Molecular weight: 17861.46 Da Isoelectric Point: 6.9790
>AT263721 WP_077246089.1 NZ_CP110362:3841769-3842257 [Dickeya dadantii]
MHKIIDVDVTGDFSLRLTYEDGLICDVDLYQYAPGPVFSNASLFIKFGLLPDGALEWLPDIKISASDLRKKGVYVGHTLA
VRERHFADVISRAFYDAVIENRPEILQAALKTAVEKHGNSTVAKEAGAKSRTSLYKSLNKNTNVSLATVVSLAHTVLQLE
EK
MHKIIDVDVTGDFSLRLTYEDGLICDVDLYQYAPGPVFSNASLFIKFGLLPDGALEWLPDIKISASDLRKKGVYVGHTLA
VRERHFADVISRAFYDAVIENRPEILQAALKTAVEKHGNSTVAKEAGAKSRTSLYKSLNKNTNVSLATVVSLAHTVLQLE
EK
Download Length: 489 bp