Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3442178..3442803 | Replicon | chromosome |
| Accession | NZ_CP110362 | ||
| Organism | Dickeya dadantii strain XJ12 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | E0SD87 |
| Locus tag | OL445_RS15555 | Protein ID | WP_009114000.1 |
| Coordinates | 3442178..3442381 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | E0SD88 |
| Locus tag | OL445_RS15560 | Protein ID | WP_013316870.1 |
| Coordinates | 3442435..3442803 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OL445_RS15525 | 3437837..3438175 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
| OL445_RS15530 | 3438218..3439510 | + | 1293 | WP_013316866.1 | ammonium transporter AmtB | - |
| OL445_RS15535 | 3439606..3440469 | - | 864 | WP_013316867.1 | acyl-CoA thioesterase II | - |
| OL445_RS15540 | 3440704..3441261 | + | 558 | WP_013316868.1 | YbaY family lipoprotein | - |
| OL445_RS15545 | 3441292..3441621 | - | 330 | WP_033111686.1 | MGMT family protein | - |
| OL445_RS15555 | 3442178..3442381 | - | 204 | WP_009114000.1 | HHA domain-containing protein | Toxin |
| OL445_RS15560 | 3442435..3442803 | - | 369 | WP_013316870.1 | Hha toxicity modulator TomB | Antitoxin |
| OL445_RS15565 | 3443311..3443454 | - | 144 | WP_013316871.1 | type B 50S ribosomal protein L36 | - |
| OL445_RS15570 | 3443470..3443721 | - | 252 | WP_013316872.1 | type B 50S ribosomal protein L31 | - |
| OL445_RS15575 | 3443901..3447047 | - | 3147 | WP_013316873.1 | efflux RND transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8133.51 Da Isoelectric Point: 8.8500
>T263720 WP_009114000.1 NZ_CP110362:c3442381-3442178 [Dickeya dadantii]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWKYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14242.11 Da Isoelectric Point: 5.1811
>AT263720 WP_013316870.1 NZ_CP110362:c3442803-3442435 [Dickeya dadantii]
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSRGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHEAALCERVEKYL
DDTYILFSNYGINDTELRKWQKSKSQLFRMFSEKSICTVVKT
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSRGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHEAALCERVEKYL
DDTYILFSNYGINDTELRKWQKSKSQLFRMFSEKSICTVVKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X3RNQ0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E0SD88 |