Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3067775..3068325 Replicon chromosome
Accession NZ_CP110362
Organism Dickeya dadantii strain XJ12

Toxin (Protein)


Gene name ccdB Uniprot ID E0SMR8
Locus tag OL445_RS13895 Protein ID WP_013316491.1
Coordinates 3068017..3068325 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID E0SMR7
Locus tag OL445_RS13890 Protein ID WP_013316490.1
Coordinates 3067775..3068014 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OL445_RS13865 3062815..3064053 - 1239 WP_013316485.1 integrase -
OL445_RS13870 3064431..3065606 - 1176 WP_284601704.1 tyrosine-type recombinase/integrase -
OL445_RS13875 3065561..3065770 - 210 WP_027711199.1 hypothetical protein -
OL445_RS13880 3066164..3066673 + 510 WP_284601706.1 DNA repair protein RadC -
OL445_RS13885 3067264..3067575 + 312 WP_284601707.1 DUF736 domain-containing protein -
OL445_RS13890 3067775..3068014 + 240 WP_013316490.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
OL445_RS13895 3068017..3068325 + 309 WP_013316491.1 CcdB family protein Toxin
OL445_RS13900 3068511..3069107 + 597 WP_148226861.1 hypothetical protein -
OL445_RS13905 3069441..3070238 + 798 WP_013316493.1 DUF2285 domain-containing protein -
OL445_RS13910 3070322..3070618 + 297 WP_033111622.1 helix-turn-helix domain-containing protein -
OL445_RS13915 3070645..3071457 + 813 WP_013316495.1 replication initiator protein A -
OL445_RS13920 3071768..3072313 + 546 WP_013316497.1 S26 family signal peptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2956589..3103140 146551


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11671.49 Da        Isoelectric Point: 5.6557

>T263719 WP_013316491.1 NZ_CP110362:3068017-3068325 [Dickeya dadantii]
MQYMVYRNNDNSRAYPYLLDVQSDIIGELHTRLVIPLFPEEKVNASVVKRLTPVLPVEGRDYLVMTHEMASVRLSQLGPQ
VMDAQAYRQSIKAALDFLLDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 9003.13 Da        Isoelectric Point: 7.2047

>AT263719 WP_013316490.1 NZ_CP110362:3067775-3068014 [Dickeya dadantii]
MPTTSIRHKKTVSVTLEPALLQQAREAGINLSATLAEALKREIRASEAERWQRENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E0SMR8

Antitoxin

Source ID Structure
AlphaFold DB E0SMR7

References