Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2926839..2927517 | Replicon | chromosome |
| Accession | NZ_CP110362 | ||
| Organism | Dickeya dadantii strain XJ12 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | E0SLQ1 |
| Locus tag | OL445_RS13305 | Protein ID | WP_013316362.1 |
| Coordinates | 2927086..2927517 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | OL445_RS13300 | Protein ID | WP_013316361.1 |
| Coordinates | 2926839..2927105 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OL445_RS13280 | 2923288..2923938 | + | 651 | WP_013316357.1 | LysE family translocator | - |
| OL445_RS13285 | 2924008..2924616 | - | 609 | WP_013316358.1 | HD domain-containing protein | - |
| OL445_RS13290 | 2924825..2925475 | + | 651 | WP_013316359.1 | hemolysin III family protein | - |
| OL445_RS13295 | 2925548..2926528 | - | 981 | WP_013316360.1 | tRNA-modifying protein YgfZ | - |
| OL445_RS13300 | 2926839..2927105 | + | 267 | WP_013316361.1 | FAD assembly factor SdhE | Antitoxin |
| OL445_RS13305 | 2927086..2927517 | + | 432 | WP_013316362.1 | protein YgfX | Toxin |
| OL445_RS13310 | 2927614..2928132 | - | 519 | WP_013316363.1 | flavodoxin FldB | - |
| OL445_RS13315 | 2928261..2929586 | - | 1326 | WP_013316364.1 | MFS transporter | - |
| OL445_RS13320 | 2929849..2930748 | + | 900 | WP_013316366.1 | site-specific tyrosine recombinase XerD | - |
| OL445_RS13325 | 2930837..2931553 | + | 717 | WP_171849779.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 16838.53 Da Isoelectric Point: 10.7687
>T263718 WP_013316362.1 NZ_CP110362:2927086-2927517 [Dickeya dadantii]
VAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPWPDGYAPLWLGLVTLVVFGFVFSQRIIKTRQGEISLHGENQLHWQQR
DWQIVRRPWLMRNGVLLSLRAVDGKGHQRLWLASDSMGNEEWRLLRQLLQQHSLQGTESSHHH
VAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPWPDGYAPLWLGLVTLVVFGFVFSQRIIKTRQGEISLHGENQLHWQQR
DWQIVRRPWLMRNGVLLSLRAVDGKGHQRLWLASDSMGNEEWRLLRQLLQQHSLQGTESSHHH
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|