Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ataRT/DUF1778(antitoxin)
Location 2688078..2688820 Replicon chromosome
Accession NZ_CP110362
Organism Dickeya dadantii strain XJ12

Toxin (Protein)


Gene name ataT Uniprot ID E0SIC1
Locus tag OL445_RS12120 Protein ID WP_013316117.1
Coordinates 2688078..2688557 (-) Length 160 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID E0SJ01
Locus tag OL445_RS12125 Protein ID WP_013316118.1
Coordinates 2688548..2688820 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OL445_RS12080 2683873..2684073 + 201 WP_026357784.1 AlpA family transcriptional regulator -
OL445_RS12085 2684070..2684351 + 282 Protein_2341 ash family protein -
OL445_RS12090 2684433..2684609 + 177 WP_231389571.1 hypothetical protein -
OL445_RS12095 2684602..2685444 + 843 Protein_2343 primase-helicase zinc-binding domain-containing protein -
OL445_RS12100 2685568..2686647 + 1080 WP_284603792.1 helicase RepA family protein -
OL445_RS12105 2686861..2687127 - 267 WP_284601522.1 helix-turn-helix transcriptional regulator -
OL445_RS12110 2687240..2687503 + 264 WP_019843648.1 helix-turn-helix transcriptional regulator -
OL445_RS12115 2687648..2688049 - 402 WP_013316116.1 hypothetical protein -
OL445_RS12120 2688078..2688557 - 480 WP_013316117.1 GNAT family N-acetyltransferase Toxin
OL445_RS12125 2688548..2688820 - 273 WP_013316118.1 DUF1778 domain-containing protein Antitoxin
OL445_RS12130 2689381..2690100 - 720 WP_284601523.1 methyltransferase domain-containing protein -
OL445_RS12135 2690111..2690368 - 258 WP_038900130.1 YjhX family toxin -
OL445_RS12140 2690822..2691160 - 339 WP_249622005.1 hypothetical protein -
OL445_RS12145 2691633..2692436 + 804 WP_033111550.1 hypothetical protein -
OL445_RS12150 2692630..2693112 - 483 WP_013316124.1 Lrp/AsnC family transcriptional regulator -
OL445_RS12155 2693276..2693650 + 375 WP_033111551.1 Dabb family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(28-147)

Antitoxin

Vibrio phage ICP1, Orf50

(10-85)


Sequences

Toxin        


Download         Length: 160 a.a.        Molecular weight: 17564.34 Da        Isoelectric Point: 9.5367

>T263717 WP_013316117.1 NZ_CP110362:c2688557-2688078 [Dickeya dadantii]
VGITAPELLLPQHAVVDFHCSEPSLNEWLKRKALKNQTLGASRTFVVCEAGTQRVVGFYALASGSIQRQVAPGAFRRNMP
DPIPVLVLGRLAVDERYQRMGIGAGLLKDAVLRSRNVAQQVGNKALLVHALSDEAKAFYQYWGFVPSEIQEHTLLLSLW

Download         Length: 480 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10384.88 Da        Isoelectric Point: 4.6702

>AT263717 WP_013316118.1 NZ_CP110362:c2688820-2688548 [Dickeya dadantii]
MRTEPKEMPINIRAKASQRELIDVAAKLLSKSRTEFILDAACREAEDVLLDQRLFLVNDEQYDAFIQVLESPVTDNPRVN
ALLNRKSPWE

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3N0G158

Antitoxin

Source ID Structure
AlphaFold DB E0SJ01

References