Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 14802..15939 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP110361 | ||
| Organism | Enterococcus faecium strain AKSZ-142 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | - |
| Locus tag | MZO31_RS14520 | Protein ID | WP_024417198.1 |
| Coordinates | 15076..15939 (+) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | R2XCR7 |
| Locus tag | MZO31_RS14515 | Protein ID | WP_000301765.1 |
| Coordinates | 14802..15074 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MZO31_RS14490 (MZO31_14490) | 10255..10935 | - | 681 | WP_002323195.1 | IS6 family transposase | - |
| MZO31_RS14495 (MZO31_14495) | 11005..11829 | + | 825 | Protein_17 | IS1380-like element ISSsu5 family transposase | - |
| MZO31_RS14500 (MZO31_14500) | 12020..13507 | + | 1488 | WP_077149152.1 | type IA DNA topoisomerase | - |
| MZO31_RS14505 (MZO31_14505) | 13610..14506 | + | 897 | WP_222056108.1 | ParA family protein | - |
| MZO31_RS14510 (MZO31_14510) | 14570..14785 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
| MZO31_RS14515 (MZO31_14515) | 14802..15074 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
| MZO31_RS14520 (MZO31_14520) | 15076..15939 | + | 864 | WP_024417198.1 | zeta toxin family protein | Toxin |
| MZO31_RS14525 (MZO31_14525) | 16202..16939 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| MZO31_RS14530 (MZO31_14530) | 17064..17147 | - | 84 | WP_031929417.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
| MZO31_RS14535 (MZO31_14535) | 17931..18182 | + | 252 | Protein_25 | hypothetical protein | - |
| MZO31_RS14540 (MZO31_14540) | 18239..18919 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| MZO31_RS14545 (MZO31_14545) | 19128..19340 | + | 213 | WP_002349227.1 | hypothetical protein | - |
| MZO31_RS14550 (MZO31_14550) | 19502..20020 | + | 519 | WP_000357244.1 | YfbU family protein | - |
| MZO31_RS14555 (MZO31_14555) | 20027..20539 | + | 513 | WP_000774078.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) / poxtA / fexB / tet(L) / tet(M) | - | 1..54197 | 54197 | |
| - | inside | IScluster/Tn | erm(B) | - | 10255..25800 | 15545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32404.02 Da Isoelectric Point: 6.9964
>T263713 WP_024417198.1 NZ_CP110361:15076-15939 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3Q8X | |
| PDB | 1GVN | |
| AlphaFold DB | A0A829F0A3 |