Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 479813..480384 | Replicon | chromosome |
Accession | NZ_CP110360 | ||
Organism | Enterococcus faecium strain AKSZ-142 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | MZO31_RS03560 | Protein ID | WP_002327666.1 |
Coordinates | 480043..480384 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | MZO31_RS03555 | Protein ID | WP_002323011.1 |
Coordinates | 479813..480043 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MZO31_RS03530 (MZO31_03525) | 475051..476379 | + | 1329 | WP_002327663.1 | FAD-containing oxidoreductase | - |
MZO31_RS03535 (MZO31_03530) | 476401..477027 | + | 627 | WP_151669150.1 | cysteine hydrolase | - |
MZO31_RS03540 (MZO31_03535) | 477210..477791 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
MZO31_RS03545 (MZO31_03540) | 478403..478978 | + | 576 | WP_002327664.1 | SOS response-associated peptidase family protein | - |
MZO31_RS03550 (MZO31_03545) | 479179..479517 | - | 339 | WP_002327665.1 | hypothetical protein | - |
MZO31_RS03555 (MZO31_03550) | 479813..480043 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
MZO31_RS03560 (MZO31_03555) | 480043..480384 | + | 342 | WP_002327666.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MZO31_RS03570 (MZO31_03565) | 482437..482580 | + | 144 | Protein_452 | class C sortase | - |
MZO31_RS03575 (MZO31_03570) | 482761..483435 | + | 675 | WP_002327673.1 | response regulator transcription factor | - |
MZO31_RS03580 (MZO31_03575) | 483453..484478 | + | 1026 | WP_002286770.1 | sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13264.67 Da Isoelectric Point: 10.1461
>T263712 WP_002327666.1 NZ_CP110360:480043-480384 [Enterococcus faecium]
VSGERIYIPKKGDIVWIYFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSGERIYIPKKGDIVWIYFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|