Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 38201..38712 Replicon plasmid pECC2783_d
Accession NZ_CP110358
Organism Enterobacter hormaechei strain ECC2783

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OLI86_RS26305 Protein ID WP_265027580.1
Coordinates 38201..38476 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OLI86_RS26310 Protein ID WP_020956904.1
Coordinates 38488..38712 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLI86_RS26275 (OLI86_26275) 34237..34524 - 288 WP_020956899.1 TrbC/VirB2 family protein -
OLI86_RS26280 (OLI86_26280) 34511..35149 - 639 WP_020956900.1 transglycosylase SLT domain-containing protein -
OLI86_RS26285 (OLI86_26285) 35363..35695 + 333 WP_227551116.1 helix-turn-helix transcriptional regulator -
OLI86_RS26290 (OLI86_26290) 35725..36915 - 1191 WP_041937886.1 MobP1 family relaxase -
OLI86_RS26295 (OLI86_26295) 36917..37471 - 555 WP_020956901.1 DNA distortion polypeptide 1 -
OLI86_RS26300 (OLI86_26300) 37913..38179 - 267 WP_265027579.1 hypothetical protein -
OLI86_RS26305 (OLI86_26305) 38201..38476 - 276 WP_265027580.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OLI86_RS26310 (OLI86_26310) 38488..38712 - 225 WP_020956904.1 DUF6290 family protein Antitoxin
OLI86_RS26315 (OLI86_26315) 39016..39264 - 249 WP_020956905.1 hypothetical protein -
OLI86_RS26320 (OLI86_26320) 39322..39534 - 213 WP_020956906.1 hypothetical protein -
OLI86_RS26325 (OLI86_26325) 39918..40199 - 282 WP_088912116.1 hypothetical protein -
OLI86_RS26330 (OLI86_26330) 40204..40425 - 222 WP_020956907.1 helix-turn-helix domain-containing protein -
OLI86_RS26335 (OLI86_26335) 40422..40667 - 246 WP_020956908.1 hypothetical protein -
OLI86_RS26340 (OLI86_26340) 40664..41206 - 543 WP_020956909.1 hypothetical protein -
OLI86_RS26345 (OLI86_26345) 41297..41821 - 525 WP_020956910.1 DnaJ domain-containing protein -
OLI86_RS26350 (OLI86_26350) 41929..42288 + 360 WP_020956911.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaKPC-2 - 1..42848 42848


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(7-88)

Antitoxin

Protein of unknown function DUF6290

(6-72)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10938.82 Da        Isoelectric Point: 10.6500

>T263710 WP_265027580.1 NZ_CP110358:c38476-38201 [Enterobacter hormaechei]
MTRYRTEYTKRFVKEFKKIDTVHQRVIQKYIEAHINNALNPRLTGKILKGDKAEFIRWRIGDYRLIATIEDDKLLVISLS
VGHRKDVYKKF

Download         Length: 276 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8535.52 Da        Isoelectric Point: 4.3313

>AT263710 WP_020956904.1 NZ_CP110358:c38712-38488 [Enterobacter hormaechei]
MNKNMTKAIRLNDEDFNLFESYANAKGITFSELCKSAVREKIEDELDLQCANESYADYLSDKTTISHDELFKSM

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References