Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 250877..251403 | Replicon | plasmid pECC2783_a |
| Accession | NZ_CP110355 | ||
| Organism | Enterobacter hormaechei strain ECC2783 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | OLI86_RS24945 | Protein ID | WP_000323025.1 |
| Coordinates | 250877..251164 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | OLI86_RS24950 | Protein ID | WP_000534858.1 |
| Coordinates | 251164..251403 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLI86_RS24910 (OLI86_24910) | 246447..246623 | - | 177 | WP_001371930.1 | hypothetical protein | - |
| OLI86_RS24915 (OLI86_24915) | 247134..248078 | + | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
| OLI86_RS24920 (OLI86_24920) | 248174..248776 | + | 603 | WP_012695474.1 | hypothetical protein | - |
| OLI86_RS24925 (OLI86_24925) | 248836..249186 | + | 351 | WP_000743059.1 | hypothetical protein | - |
| OLI86_RS24930 (OLI86_24930) | 249233..249436 | + | 204 | WP_001015183.1 | hypothetical protein | - |
| OLI86_RS24935 (OLI86_24935) | 249718..250038 | + | 321 | WP_000332796.1 | hypothetical protein | - |
| OLI86_RS24940 (OLI86_24940) | 250651..250776 | - | 126 | WP_229020258.1 | DUF5431 family protein | - |
| OLI86_RS24945 (OLI86_24945) | 250877..251164 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| OLI86_RS24950 (OLI86_24950) | 251164..251403 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| OLI86_RS24955 (OLI86_24955) | 251428..251532 | + | 105 | Protein_256 | protein YdfV | - |
| OLI86_RS24960 (OLI86_24960) | 251666..252589 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| OLI86_RS24965 (OLI86_24965) | 252789..253361 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| OLI86_RS24970 (OLI86_24970) | 253837..255075 | - | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
| OLI86_RS24975 (OLI86_24975) | 255497..255574 | - | 78 | Protein_260 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA1 / aadA5 / qacE / sul1 / armA / mph(E) / catA2 / sul2 / tet(A) / aph(6)-Id / aph(3'')-Ib / blaTEM-1B / mcr-9 | - | 1..286232 | 286232 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T263709 WP_000323025.1 NZ_CP110355:c251164-250877 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|