Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 4806103..4806719 | Replicon | chromosome |
| Accession | NZ_CP110354 | ||
| Organism | Enterobacter hormaechei strain ECC2783 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OLI86_RS23285 | Protein ID | WP_015569913.1 |
| Coordinates | 4806103..4806474 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | OLI86_RS23290 | Protein ID | WP_015569912.1 |
| Coordinates | 4806477..4806719 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLI86_RS23270 (OLI86_23270) | 4803603..4804505 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| OLI86_RS23275 (OLI86_23275) | 4804502..4805137 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OLI86_RS23280 (OLI86_23280) | 4805134..4806063 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| OLI86_RS23285 (OLI86_23285) | 4806103..4806474 | - | 372 | WP_015569913.1 | PIN domain-containing protein | Toxin |
| OLI86_RS23290 (OLI86_23290) | 4806477..4806719 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| OLI86_RS23295 (OLI86_23295) | 4806918..4807838 | + | 921 | WP_015569911.1 | alpha/beta hydrolase | - |
| OLI86_RS23300 (OLI86_23300) | 4807847..4808788 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| OLI86_RS23305 (OLI86_23305) | 4808833..4809270 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| OLI86_RS23310 (OLI86_23310) | 4809267..4810148 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| OLI86_RS23315 (OLI86_23315) | 4810142..4810741 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
| OLI86_RS23320 (OLI86_23320) | 4810860..4811660 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13767.90 Da Isoelectric Point: 6.4882
>T263707 WP_015569913.1 NZ_CP110354:c4806474-4806103 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|