Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3866467..3867124 | Replicon | chromosome |
Accession | NZ_CP110354 | ||
Organism | Enterobacter hormaechei strain ECC2783 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A179PSF7 |
Locus tag | OLI86_RS18740 | Protein ID | WP_017382887.1 |
Coordinates | 3866467..3866877 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | OLI86_RS18745 | Protein ID | WP_003863437.1 |
Coordinates | 3866858..3867124 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLI86_RS18720 (OLI86_18720) | 3862465..3864198 | - | 1734 | WP_023304383.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OLI86_RS18725 (OLI86_18725) | 3864204..3864917 | - | 714 | WP_023295380.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OLI86_RS18730 (OLI86_18730) | 3864946..3865842 | - | 897 | WP_023304385.1 | site-specific tyrosine recombinase XerD | - |
OLI86_RS18735 (OLI86_18735) | 3865944..3866465 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
OLI86_RS18740 (OLI86_18740) | 3866467..3866877 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
OLI86_RS18745 (OLI86_18745) | 3866858..3867124 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
OLI86_RS18750 (OLI86_18750) | 3867419..3868399 | + | 981 | WP_022649306.1 | tRNA-modifying protein YgfZ | - |
OLI86_RS18755 (OLI86_18755) | 3868511..3869170 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
OLI86_RS18760 (OLI86_18760) | 3869437..3870168 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
OLI86_RS18765 (OLI86_18765) | 3870285..3871718 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T263706 WP_017382887.1 NZ_CP110354:c3866877-3866467 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A179PSF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |